From AureoWiki
Revision as of 23:04, 10 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "gene Genbank" to "gene RefSeq")
Jump to navigation Jump to search

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS00215 [old locus tag: SA0014 ]
  • symbol: SA_RS00215
  • product: 50S ribosomal protein L9
  • replicon: chromosome
  • strand: +
  • coordinates: 20292..20738
  • length: 447
  • essential: yes [1] DEG other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: WP_000864305 NCBI

Phenotype[edit | edit source]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAAAGTAATTTTTACACAAGATGTTAAAGGTAAAGGTAAAAAAGGTGAAGTTAAAGAA
    GTACCAGTAGGTTATGCAAATAACTTCTTATTGAAAAAGAATTATGCTGTAGAAGCAACA
    CCAGGTAACCTTAAACAATTAGAGTTACAGAAAAAACGTGCAAAACAAGAACGCCAACAA
    GAAATTGAAGATGCTAAAGCATTAAAAGAAACGTTATCAAACATTGAAGTTGAAGTATCA
    GCAAAAACTGGTGAAGGTGGTAAATTGTTTGGATCAGTAAGTACAAAACAAATTGCCGAA
    GCACTAAAAGCACAACATGATATTAAAATTGATAAACGTAAAATGGATTTACCAAATGGA
    ATTCATTCCCTAGGATATACGAATGTACCTGTTAAATTAGATAAAGAAGTTGAAGGTACA
    ATTCGCGTACACACAGTTGAACAATAA
    60
    120
    180
    240
    300
    360
    420
    447

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS00215 [old locus tag: SA0014 ]
  • symbol: SA_RS00215
  • description: 50S ribosomal protein L9
  • length: 148
  • theoretical pI: 10.0654
  • theoretical MW: 16453.8
  • GRAVY: -0.681757

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL9 (TIGR00158; HMM-score: 149.7)
  • TheSEED: see SA0014
  • PFAM:
    no clan defined Ribosomal_L9_C; Ribosomal protein L9, C-terminal domain (PF03948; HMM-score: 98.6)
    and 1 more
    Ribosomal_L9_N; Ribosomal protein L9, N-terminal domain (PF01281; HMM-score: 78.1)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • interaction partners:
    SA_RS02405methionine ABC transporter substrate-binding protein  [2] (data from MRSA252)
    SA_RS0290550S ribosomal protein L11  [2] (data from MRSA252)
    SA_RS0291550S ribosomal protein L10  [2] (data from MRSA252)
    SA_RS08560pyruvate kinase  [2] (data from MRSA252)
    SA_RS1176050S ribosomal protein L4  [2] (data from MRSA252)

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005569
    • TAT(Tat/SPI): 0.00029
    • LIPO(Sec/SPII): 0.00142
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446787049 NCBI
  • UniProt: see SA0014
  • protein Genbank : _
  • RefSeq: WP_000864305 NCBI

Protein sequence[edit | edit source]

  • MKVIFTQDVKGKGKKGEVKEVPVGYANNFLLKKNYAVEATPGNLKQLELQKKRAKQERQQEIEDAKALKETLSNIEVEVSAKTGEGGKLFGSVSTKQIAEALKAQHDIKIDKRKMDLPNGIHSLGYTNVPVKLDKEVEGTIRVHTVEQ

Peptides[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • sigma factors : _
  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
    A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
    Mol Microbiol: 2002, 43(6);1387-400
    [PubMed:11952893] [WorldCat.org] [DOI] (P p)
  2. 2.0 2.1 2.2 2.3 2.4 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]