From AureoWiki
Revision as of 18:56, 10 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "gene Genbank" to "gene RefSeq")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 23-MAY-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_pUSA030011 [new locus tag: SAUSA300_RS14790 ]
  • pan locus tag?:
  • symbol: traB
  • pan gene symbol?:
  • synonym:
  • product: transfer complex protein TraB

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_pUSA030011 [new locus tag: SAUSA300_RS14790 ]
  • symbol: traB
  • product: transfer complex protein TraB
  • replicon: pUSA03
  • strand: +
  • coordinates: 11030..11347
  • length: 318
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGATTAAAAAATTCAGTTTAACAACTGTTTATGTAGCATTTTTAAGCATTGTTTTATCA
    AATATAACACTTGGCGCAGAAAATCCAGGGCCGAAAATTGAACAAGGTTTACAACAAGTA
    CAAACATTCTTAACAGGCCTAATTGTTGCTGTTGGTATCTGTGCTGGTGTTTGGATAGTT
    CTTAAAAAATTACCTGGAATTGATGATCCAATGGTAAAAAATGAAATGTTTAGAGGCGTT
    GGAATGGTATTAGCTGGTGTGGCTGTTGGGGCAGCACTTGTTTGGTTGGTTCCATGGGTA
    TACAACCTTTTCCAATAA
    60
    120
    180
    240
    300
    318

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_pUSA030011 [new locus tag: SAUSA300_RS14790 ]
  • symbol: TraB
  • description: transfer complex protein TraB
  • length: 105
  • theoretical pI: 9.19725
  • theoretical MW: 11317.6
  • GRAVY: 0.862857

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • protein TrsB
  • PFAM:
    no clan defined T4SS_CagC; Cag pathogenicity island, type IV secretory system (PF16943; HMM-score: 62.8)
    and 5 more
    TrbC; TrbC/VIRB2 family (PF04956; HMM-score: 23.6)
    DUF2157; Predicted membrane protein (DUF2157) (PF09925; HMM-score: 21.1)
    Maff2; Maff2 family (PF12750; HMM-score: 14.2)
    SecE; SecE/Sec61-gamma subunits of protein translocation complex (PF00584; HMM-score: 10.4)
    O-anti_assembly (CL0499) Wzy_C; O-Antigen ligase (PF04932; HMM-score: 8.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0
    • Signal peptide possibility: 0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: Signal peptide SP(Sec/SPI) length 25 aa
    • SP(Sec/SPI): 0.696851
    • TAT(Tat/SPI): 0.001428
    • LIPO(Sec/SPII): 0.076762
    • Cleavage Site: CS pos: 25-26. TLG-AE. Pr: 0.4498
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MIKKFSLTTVYVAFLSIVLSNITLGAENPGPKIEQGLQQVQTFLTGLIVAVGICAGVWIVLKKLPGIDDPMVKNEMFRGVGMVLAGVAVGAALVWLVPWVYNLFQ

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]