COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

⊟Summary

• organism: Staphylococcus aureus USA300_FPR3757
• locus tag: SAUSA300_RS14990
• pan locus tag^?:
• symbol: SAUSA300_RS14990
• pan gene symbol^?: —
• synonym:
• product: NAD(P)/FAD-dependent oxidoreductase

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: SAUSA300_RS14990
• symbol: SAUSA300_RS14990
• product: NAD(P)/FAD-dependent oxidoreductase
• replicon: chromosome
• strand: +
• coordinates: 95561..95815
• length: 255
• essential: unknown

⊟Accession numbers

• Location: NC_007793 (95561..95815) NCBI
• BioCyc:
• MicrobesOnline:

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  181
  241
  
  ATGAATAAGCATTATCAAATTGTTATTATTGGTGGCGGTACAGCAGGTGTTACCGTAGCA
  TCAAGACTATTAAGAAAAAATCAAAACTTAAAAGAGAAAATAGCAATTATAGATCCAGCA
  GACCATCATTACTATCAACCATTATGGACGTTGGTTGGTGCAGGGGTATCTAGTTTGAAA
  AGTTCTCGTAAAGATATGGAAAGTGTTATACCTGAAGGTGCTAACTGGATAAAACAGGCT
  GTTTCAAGTTTTTAA
  60
  120
  180
  240
  255
  

⊟Protein

⊟General

• locus tag: SAUSA300_RS14990
• symbol: SAUSA300_RS14990
• description: NAD(P)/FAD-dependent oxidoreductase
• length: 84
• theoretical pI: 10.1846
• theoretical MW: 9234.58
• GRAVY: -0.164286

⊟Function

• TIGRFAM:
  Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family (TIGR01988; EC 1.14.13.-; HMM-score: 18.9)
  lycopene cyclase family protein (TIGR01790; HMM-score: 17.3)
  ubiquinone biosynthesis monooxygenase COQ6 (TIGR01989; EC 1.14.13.-; HMM-score: 16.9)
  Cellular processes Cellular processes Detoxification CoA-disulfide reductase (TIGR03385; EC 1.8.1.14; HMM-score: 16.5)
  Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone 2-polyprenyl-6-methoxyphenol 4-hydroxylase (TIGR01984; EC 1.14.13.-; HMM-score: 15.8)
  and 9 more
  Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain (TIGR03197; HMM-score: 13.4)
  squalene-associated FAD-dependent desaturase (TIGR03467; HMM-score: 12.7)
  Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll geranylgeranyl reductase family (TIGR02032; EC 1.3.1.-; HMM-score: 12.4)
  salicylate 1-monooxygenase (TIGR03219; EC 1.14.13.1; HMM-score: 12.2)
  Metabolism Amino acid biosynthesis Glutamate family pyrroline-5-carboxylate reductase (TIGR00112; EC 1.5.1.2; HMM-score: 12)
  Unknown function Enzymes of unknown specificity flavoprotein, HI0933 family (TIGR00275; HMM-score: 11.9)
  Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Thiamine glycine oxidase ThiO (TIGR02352; EC 1.4.3.19; HMM-score: 11.9)
  Metabolism Energy metabolism Anaerobic glycerol-3-phosphate dehydrogenase, anaerobic, B subunit (TIGR03378; EC 1.1.5.3; HMM-score: 11.1)
  flavin-dependent oxidoreductase, MSMEG_0569 family (TIGR04046; HMM-score: 11)
• TheSEED:
• PFAM:
  NADP_Rossmann (CL0063) Pyr_redox_2; Pyridine nucleotide-disulphide oxidoreductase (PF07992; HMM-score: 25.4)
  NAD_binding_9; FAD-NAD(P)-binding (PF13454; HMM-score: 24.7)
  Lycopene_cycl; Lycopene cyclase protein (PF05834; HMM-score: 21.3)
  and 9 more
  NAD_binding_8; NAD(P)-binding Rossmann-like domain (PF13450; HMM-score: 20)
  Sacchrp_dh_NADP; Saccharopine dehydrogenase NADP binding domain (PF03435; HMM-score: 19.7)
  DAO; FAD dependent oxidoreductase (PF01266; HMM-score: 19.5)
  Pyr_redox; Pyridine nucleotide-disulphide oxidoreductase (PF00070; HMM-score: 17.5)
  TrkA_N; TrkA-N domain (PF02254; HMM-score: 17.4)
  Trp_halogenase; Tryptophan halogenase (PF04820; HMM-score: 17.3)
  F420_oxidored; NADP oxidoreductase coenzyme F420-dependent (PF03807; HMM-score: 16.6)
  Thi4; Thi4 family (PF01946; HMM-score: 14)
  HI0933_like; HI0933-like protein (PF03486; HMM-score: 12.8)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:

⊟Localization

• PSORTb: unknown (no significant prediction)
  • Cytoplasmic Score: 2.5
  • Cytoplasmic Membrane Score: 2.5
  • Cellwall Score: 2.5
  • Extracellular Score: 2.5
  • Internal Helix: 1
• LocateP:
• SignalP: no predicted signal peptide
  • SP(Sec/SPI): 0.021445
  • TAT(Tat/SPI): 0.002427
  • LIPO(Sec/SPII): 0.015703
• predicted transmembrane helices (TMHMM): 1

⊟Accession numbers

• GI:
• RefSeq: WP_001033014 NCBI
• UniProt:

⊟Protein sequence

• MNKHYQIVIIGGGTAGVTVASRLLRKNQNLKEKIAIIDPADHHYYQPLWTLVGAGVSSLKSSRKDMESVIPEGANWIKQAVSSF

⊟Experimental data

• experimentally validated:
• protein localization:
• quantitative data / protein copy number per cell:
• interaction partners:

⊟Expression & Regulation

⊟Operon

⊟Regulation

• regulator:

⊟Transcription pattern

• S.aureus Expression Data Browser: no data available

⊟Protein synthesis (provided by Aureolib)

• Aureolib: no data available

⊟Protein stability

• half-life: no data available

⊟Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊟Other Information

You are kindly invited to share additional interesting facts.

⊟Literature

⊟References

⊟Relevant publications