From AureoWiki
Jump to navigation Jump to search
m (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "")
m (Text replacement - "gene Genbank" to "gene RefSeq")
 
Line 1: Line 1:
__TOC__
<protect>
<protect>
<aureodatabase>NCBI date</aureodatabase>
<aureodatabase>annotation</aureodatabase>


=Summary=
=Summary=


* <aureodatabase>organism</aureodatabase>
*<aureodatabase>organism</aureodatabase>
* <aureodatabase>locus</aureodatabase>
*<aureodatabase>locus</aureodatabase>
* <aureodatabase>pan locus</aureodatabase>
*<aureodatabase>pan locus</aureodatabase>
* <aureodatabase>gene symbol</aureodatabase>
*<aureodatabase>gene symbol</aureodatabase>
* <aureodatabase>pan gene symbol</aureodatabase>
*<aureodatabase>pan gene symbol</aureodatabase>
* <aureodatabase>gene synonyms</aureodatabase>
*<aureodatabase>gene synonyms</aureodatabase>
* <aureodatabase>product</aureodatabase>
*<aureodatabase>product</aureodatabase>
</protect>
</protect>


Line 24: Line 25:
==General==
==General==


* <aureodatabase>gene type</aureodatabase>
*<aureodatabase>gene type</aureodatabase>
* <aureodatabase>locus</aureodatabase>
*<aureodatabase>locus</aureodatabase>
* <aureodatabase>gene symbol</aureodatabase>
*<aureodatabase>gene symbol</aureodatabase>
* <aureodatabase>product</aureodatabase>
*<aureodatabase>product</aureodatabase>
* <aureodatabase>gene replicon</aureodatabase>
*<aureodatabase>gene replicon</aureodatabase>
* <aureodatabase>strand</aureodatabase>
*<aureodatabase>strand</aureodatabase>
* <aureodatabase>gene coordinates</aureodatabase>
*<aureodatabase>gene coordinates</aureodatabase>
* <aureodatabase>gene length</aureodatabase>
*<aureodatabase>gene length</aureodatabase>
* <aureodatabase>essential</aureodatabase>
*<aureodatabase>essential</aureodatabase>
*<aureodatabase>gene comment</aureodatabase>
</protect>
</protect>


Line 38: Line 40:
==Accession numbers==
==Accession numbers==


* <aureodatabase>gene GI</aureodatabase>
*<aureodatabase>gene location</aureodatabase>
* <aureodatabase>gene Genbank</aureodatabase>
*<aureodatabase>gene BioCyc</aureodatabase>
*<aureodatabase>gene MicrobesOnline</aureodatabase>
</protect>
</protect>
   
   
<protect>  
<protect>
==Phenotype==
==Phenotype==
</protect>
</protect>
* Share your knowledge and add information here. [<span class="plainlinks">[http://www.protecs.uni-greifswald.de/aureowiki/index.php?title={{PAGENAMEE}}&action=edit&section=6 edit]</span>]
Share your knowledge and add information here. [<span class="plainlinks">[//aureowiki.med.uni-greifswald.de/index.php?title={{PAGENAMEE}}&veaction=edit&section=6 edit]</span>]


<protect>
<protect>
==DNA sequence==
==DNA sequence==


* <aureodatabase>gene sequence</aureodatabase>
*<aureodatabase>gene sequence</aureodatabase>
</protect>
</protect>


<protect>
<protect>
<aureodatabase>RNA regulated operons</aureodatabase>
</protect>


<protect>
=Protein=
=Protein=
<aureodatabase>protein 3D view</aureodatabase>
<aureodatabase>protein 3D view</aureodatabase>
==General==
==General==


* <aureodatabase>locus</aureodatabase>
*<aureodatabase>locus</aureodatabase>
* <aureodatabase>protein symbol</aureodatabase>
*<aureodatabase>protein symbol</aureodatabase>
* <aureodatabase>protein description</aureodatabase>
*<aureodatabase>protein description</aureodatabase>
* <aureodatabase>protein length</aureodatabase>
*<aureodatabase>protein length</aureodatabase>
* <aureodatabase>theoretical pI</aureodatabase>
*<aureodatabase>theoretical pI</aureodatabase>
* <aureodatabase>theoretical MW</aureodatabase>
*<aureodatabase>theoretical MW</aureodatabase>
* <aureodatabase>GRAVY</aureodatabase>
*<aureodatabase>GRAVY</aureodatabase>
</protect>
</protect>


Line 71: Line 77:
==Function==
==Function==


* <aureodatabase>protein reaction</aureodatabase>
*<aureodatabase>protein reaction</aureodatabase>
* <aureodatabase>protein TIGRFAM</aureodatabase>
*<aureodatabase>protein TIGRFAM</aureodatabase>
* <aureodatabase>protein TheSeed</aureodatabase>
*<aureodatabase>protein TheSeed</aureodatabase>
* <aureodatabase>protein PFAM</aureodatabase>
*<aureodatabase>protein PFAM</aureodatabase>
</protect>
</protect>


<protect>
<protect>
==Structure, modifications & interactions==
==Structure, modifications & cofactors==


* <aureodatabase>protein domains</aureodatabase>
*<aureodatabase>protein domains</aureodatabase>
* <aureodatabase>protein modifications</aureodatabase>
*<aureodatabase>protein modifications</aureodatabase>
* <aureodatabase>protein cofactors</aureodatabase>
*<aureodatabase>protein cofactors</aureodatabase>
* <aureodatabase>protein effectors</aureodatabase>
*<aureodatabase>protein effectors</aureodatabase>
* <aureodatabase>protein partners</aureodatabase>
*<aureodatabase>protein regulated operons</aureodatabase>
</protect>
</protect>


Line 90: Line 96:
==Localization==
==Localization==


* <aureodatabase>protein Psortb</aureodatabase>
*<aureodatabase>protein Psortb</aureodatabase>
* <aureodatabase>protein LocateP</aureodatabase>
*<aureodatabase>protein LocateP</aureodatabase>
* <aureodatabase>protein SignalP</aureodatabase>
*<aureodatabase>protein SignalP</aureodatabase>
* <aureodatabase>protein TMHMM</aureodatabase>
*<aureodatabase>protein TMHMM</aureodatabase>
</protect>
</protect>


Line 99: Line 105:
==Accession numbers==
==Accession numbers==


* <aureodatabase>protein GI</aureodatabase>
*<aureodatabase>protein GI</aureodatabase>
* <aureodatabase>protein UniProt</aureodatabase>
*<aureodatabase>protein RefSeq</aureodatabase>
* <aureodatabase>protein RefSeq</aureodatabase>
*<aureodatabase>protein UniProt</aureodatabase>
</protect>
</protect>


Line 107: Line 113:
==Protein sequence==
==Protein sequence==


* <aureodatabase>protein sequence</aureodatabase>
*<aureodatabase>protein sequence</aureodatabase>
</protect>
</protect>


<protect>
<protect>
==Peptides==
==Experimental data==


* <aureodatabase>protein validated peptides</aureodatabase>
*<aureodatabase>protein validated peptides</aureodatabase>
*<aureodatabase>protein validated localization</aureodatabase>
*<aureodatabase>protein validated quantitative data</aureodatabase>
*<aureodatabase>protein partners</aureodatabase>
</protect>
</protect>


Line 124: Line 133:
==Operon==
==Operon==


* <aureodatabase>operons</aureodatabase>
*<aureodatabase>operons</aureodatabase>
</protect>
</protect>


Line 130: Line 139:
==Regulation==
==Regulation==


* <aureodatabase>sigma factors</aureodatabase>
*<aureodatabase>regulators</aureodatabase>
* <aureodatabase>regulators</aureodatabase>
</protect>
</protect>


Line 137: Line 145:
==Transcription pattern==
==Transcription pattern==


* <aureodatabase>expression browser</aureodatabase>
*<aureodatabase>expression browser</aureodatabase>
</protect>
</protect>


Line 143: Line 151:
==Protein synthesis (provided by Aureolib)==
==Protein synthesis (provided by Aureolib)==


* <aureodatabase>protein synthesis Aureolib</aureodatabase>
*<aureodatabase>protein synthesis Aureolib</aureodatabase>
</protect>
</protect>


<protect>
<protect>
==Stability==
==Protein stability==


* <aureodatabase>protein half-life</aureodatabase>
*<aureodatabase>protein half-life</aureodatabase>
</protect>
</protect>



Latest revision as of 14:00, 11 March 2016

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS14440 [old locus tag: SAUSA300_2597 ]
  • pan locus tag?: SAUPAN006408000
  • symbol: SAUSA300_RS14440
  • pan gene symbol?: cap1B
  • synonym:
  • product: capsular polysaccharide biosynthesis protein Cap5B

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS14440 [old locus tag: SAUSA300_2597 ]
  • symbol: SAUSA300_RS14440
  • product: capsular polysaccharide biosynthesis protein Cap5B
  • replicon: chromosome
  • strand: -
  • coordinates: 2823668..2824360
  • length: 693
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGACGAATACACGAAGAAGTACATCAAGTTTAATTGTCCATGAACAACCAAAGTCACCT
    ATTAGCGAGAAATTTCGAGGCATAAGATCAAATATTATGTTTGCAAATCCTGACAGTGCA
    GTTCAAAGCATTGTAATCACTTCAGAGGCACCAGGCGCAGGTAAGTCTACAATTGCAGCA
    AATTTAGCAGTTGCATATGCGCAAGCAGGTTATAAAACACTAATCGTAGACGGGGATATG
    CGTAAACCTACGCAGCATTATATTTTTAATTTGCCAAACAATGAAGGCCTATCAAGTTTA
    TTGCTAAATTGGTCAACTTATCAAGACAGTATTATCTCAACTGAAATTCAAGATTTAGAC
    GTCTTGACGTCTGGGCCAATCCCACCGAATCCGTCAGAGTTAATTACATCAAGGGCATTT
    GCAAATTTGTATGACACATTATTGATGAATTATAACTTTGTAATTATCGATACGCCACCA
    GTGAACACAGTTACAGATGCGCAATTATTTTCAAAGTTTACCGGCAATGTTGTCTACGTA
    GTTAATTCGGAAAATAATAATAGAGATGAAGTTAAAAAAGGAAAAGAACTTATTGAAGCA
    ACAGGTGCTAAATTATTAGGTGTAGTCTTAAATAGAATGCCTAAAGATAAAAGTGCTAGT
    TACTATGCATATTATGGGACTGATGAATCATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    693

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS14440 [old locus tag: SAUSA300_2597 ]
  • symbol: SAUSA300_RS14440
  • description: capsular polysaccharide biosynthesis protein Cap5B
  • length: 230
  • theoretical pI: 5.30455
  • theoretical MW: 25251.3
  • GRAVY: -0.247391

Function[edit | edit source]

  • reaction:
    EC 2.7.10.1?  ExPASy
    Receptor protein-tyrosine kinase ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate
  • TIGRFAM:
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids capsular exopolysaccharide family (TIGR01007; HMM-score: 258.7)
    and 17 more
    chain length determinant protein tyrosine kinase EpsG (TIGR03029; HMM-score: 145.5)
    exopolysaccharide/PEP-CTERM locus tyrosine autokinase (TIGR03018; EC 2.7.10.2; HMM-score: 129.1)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids exopolysaccharide transport protein family (TIGR01005; HMM-score: 113.1)
    cell division ATPase MinD (TIGR01969; HMM-score: 55.5)
    Cellular processes Cellular processes Cell division septum site-determining protein MinD (TIGR01968; HMM-score: 40.2)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides cellulose synthase operon protein YhjQ (TIGR03371; HMM-score: 37.4)
    helicase/secretion neighborhood CpaE-like protein (TIGR03815; HMM-score: 25.7)
    Metabolism Central intermediary metabolism Nitrogen fixation nitrogenase iron protein (TIGR01287; EC 1.18.6.1; HMM-score: 17.4)
    Genetic information processing Mobile and extrachromosomal element functions Plasmid functions plasmid partitioning protein RepA (TIGR03453; HMM-score: 17.4)
    Hypothetical proteins Conserved transport-energizing ATPase, TRC40/GET3/ArsA family (TIGR00345; EC 3.6.1.-; HMM-score: 16.7)
    arsenical pump-driving ATPase (TIGR04291; EC 3.6.1.-; HMM-score: 16.3)
    Metabolism Central intermediary metabolism Sulfur metabolism adenylyl-sulfate kinase (TIGR00455; EC 2.7.1.25; HMM-score: 16.2)
    putative cytidylate kinase (TIGR02173; EC 2.7.4.14; HMM-score: 14.1)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein (TIGR01281; EC 1.3.7.7; HMM-score: 13.8)
    signal recognition particle protein SRP54 (TIGR01425; HMM-score: 12.8)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking signal recognition particle-docking protein FtsY (TIGR00064; HMM-score: 11.7)
    HprK-related kinase A (TIGR04352; HMM-score: 10.9)
  • TheSEED: see SAUSA300_2597
  • PFAM:
    P-loop_NTPase (CL0023) CbiA; CobQ/CobB/MinD/ParA nucleotide binding domain (PF01656; HMM-score: 51.7)
    ParA; NUBPL iron-transfer P-loop NTPase (PF10609; HMM-score: 46.5)
    AAA_31; AAA domain (PF13614; HMM-score: 45.8)
    and 14 more
    MipZ; ATPase MipZ (PF09140; HMM-score: 35.6)
    CBP_BcsQ; Cellulose biosynthesis protein BcsQ (PF06564; HMM-score: 27.7)
    ArsA_ATPase; Anion-transporting ATPase (PF02374; HMM-score: 20.1)
    AAA_26; AAA domain (PF13500; HMM-score: 20)
    AAA_25; AAA domain (PF13481; HMM-score: 16.9)
    APS_kinase; Adenylylsulphate kinase (PF01583; HMM-score: 16.4)
    CLP1_P; mRNA cleavage and polyadenylation factor CLP1 P-loop (PF16575; HMM-score: 15.9)
    SRP54; SRP54-type protein, GTPase domain (PF00448; HMM-score: 14.8)
    Fer4_NifH; 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family (PF00142; HMM-score: 14.6)
    KTI12; Chromatin associated protein KTI12 (PF08433; HMM-score: 12.3)
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 12.2)
    ArgK; ArgK protein (PF03308; HMM-score: 12)
    AAA_24; AAA domain (PF13479; HMM-score: 12)
    AAA_30; AAA domain (PF13604; HMM-score: 12)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.01
    • Cytoplasmic Membrane Score: 9.99
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.024914
    • TAT(Tat/SPI): 0.011712
    • LIPO(Sec/SPII): 0.002336
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDMRKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIQDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPPVNTVTDAQLFSKFTGNVVYVVNSENNNRDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]