NCBI date : _
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS13850 [old locus tag: SAUSA300_2493 ]
- pan locus tag?: SAUPAN006219000
- symbol: SAUSA300_RS13850
- pan gene symbol?: cwrA
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS13850 [old locus tag: SAUSA300_2493 ]
- symbol: SAUSA300_RS13850
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 2696111..2696302
- length: 192
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- gene Genbank : _
⊟Phenotype[edit | edit source]
- Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAGAATATTAATTACAGGCACAGTTGCTATCTTAATCATTCTAGGTTTGGTCAAAACG
ATACAAGATTACGAAATGACAAACGACACGAGTCGTCAGTTGTCAGACAACAAAGATGAT
GATAAAGTCATCCATCTTAATAATTTTAAAAATTTACATGCGAAAGAATTTAACCCATCT
GATTTCTTTTAA60
120
180
192
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS13850 [old locus tag: SAUSA300_2493 ]
- symbol: SAUSA300_RS13850
- description: hypothetical protein
- length: 63
- theoretical pI: 5.58216
- theoretical MW: 7266.26
- GRAVY: -0.233333
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAUSA300_2493
- PFAM:
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- interaction partners:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 9.87
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- LocateP:
- SignalP: Signal peptide SP(Sec/SPI) length 20 aa
- SP(Sec/SPI): 0.461237
- TAT(Tat/SPI): 0.000815
- LIPO(Sec/SPII): 0.122821
- Cleavage Site: CS pos: 20-21. VKT-IQ. Pr: 0.0791
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI: 447144148 NCBI
- UniProt: see SAUSA300_2493
- RefSeq: WP_001221404 NCBI
⊟Protein sequence[edit | edit source]
- MRILITGTVAILIILGLVKTIQDYEMTNDTSRQLSDNKDDDKVIHLNNFKNLHAKEFNPSDFF
⊟Peptides[edit | edit source]
- experimentally validated: data available for NCTC8325
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- sigma factors : _
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.