NCBI date : _
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS13670 [old locus tag: SAUSA300_2465 ]
- pan locus tag?: SAUPAN006176000
- symbol: SAUSA300_RS13670
- pan gene symbol?: —
- synonym:
- product: peptide ABC transporter ATP-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS13670 [old locus tag: SAUSA300_2465 ]
- symbol: SAUSA300_RS13670
- product: peptide ABC transporter ATP-binding protein
- replicon: chromosome
- strand: +
- coordinates: 2661782..2662417
- length: 636
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: WP_000773921 NCBI
⊟Phenotype[edit | edit source]
- Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601ATGAAACTAAATAACTATTCTTTAAAAGTTAAAAACAAACAACTAGTTGACAATTGTGAT
TTAAATTTCTATCTTGGTCAGATCAATCACATTGTTGGTAAAAATGGTGTAGGAAAATCT
TTATTAGCTAAAGATTTCTTACTAAATAATAGTGGAAATATCCCTAAGTCCATTTCTCAA
AATGTAACCTTAATATCAAGTTCATCAAATATTCCTAATGATATAACAAAAGATTTTTTA
TTATCATTGTTAAAATCAAAATTTGAAAACAATCGACAAACATTCGATAAGATTTATAAC
ATACTAAACATCGAAGCAATACCGTCTAACGTACTACTAAAAAACTTGAGTGATGGTCAA
AAACAAAAGCTTAAATTATTAAGTTTCTTATTGGAAGATCATGATTTAATCATATTAGAT
GAAGTTACAAACGCTTTAGACAAGAAAACAGTTAATGAAATTTATGAATTTTTAAATGAT
TTTATTCAAAGCCATCAAACTAAAACTATTATCAATATTACACATAATTTATCCGATTTA
AGTGCTTTGCCGGGTAAATACTTTATTTTTAAAGACCTTCAAATAGAAGAGTACCAATCA
AAAGAAGAAGTCATAAATGATTACATTAATTTATAA60
120
180
240
300
360
420
480
540
600
636
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS13670 [old locus tag: SAUSA300_2465 ]
- symbol: SAUSA300_RS13670
- description: peptide ABC transporter ATP-binding protein
- length: 211
- theoretical pI: 6.52286
- theoretical MW: 24107.4
- GRAVY: -0.269668
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 69.3)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 61.9)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 58.3)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 58.3)and 66 moreTransport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 51.7)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 46.8)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 46.6)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 46.6)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 45.2)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 44.5)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 44.5)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 44.2)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 44)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 43.2)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 43.2)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 42.7)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 42.2)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 41.7)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 41.5)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 41.3)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 41.1)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 40.5)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 40.4)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 39.9)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 38.4)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 38.3)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 38.3)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 38)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 37.9)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 37.6)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 37.4)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 37.1)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 37.1)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 36.6)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 36.6)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 35.1)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 34.9)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 34.9)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 34.1)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 33.8)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 33.7)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 33.5)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 33.1)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 32.4)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 32.4)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 32)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 32)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 32)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 30.9)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 30.1)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 28.6)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 26.8)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 26.7)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 26.7)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 26.3)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 25.2)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 25.2)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 25.1)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 24)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 24)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 23.8)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 23.8)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 22.4)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 20.9)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 20)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 19.4)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 15.2)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 12.4)Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 10.4)DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 10.4)
- TheSEED: see SAUSA300_2465
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 51.3)and 13 moreAAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 37.9)AAA_22; AAA domain (PF13401; HMM-score: 31.3)SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 22.3)NB-ARC; NB-ARC domain (PF00931; HMM-score: 20.5)ATPase; KaiC (PF06745; HMM-score: 16.1)HTH (CL0123) Tn7_Tnp_TnsA_C; TnsA endonuclease C terminal (PF08721; HMM-score: 15.6)P-loop_NTPase (CL0023) AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 15.3)NACHT; NACHT domain (PF05729; HMM-score: 15.3)AAA_16; AAA ATPase domain (PF13191; HMM-score: 14)CobA_CobO_BtuR; ATP:corrinoid adenosyltransferase BtuR/CobO/CobP (PF02572; HMM-score: 13.8)RNA_helicase; RNA helicase (PF00910; HMM-score: 13.1)IstB_IS21; IstB-like ATP binding protein (PF01695; HMM-score: 13.1)AAA_23; AAA domain (PF13476; HMM-score: 9.8)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- interaction partners:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.17
- Cytoplasmic Membrane Score: 9.51
- Cellwall Score: 0.16
- Extracellular Score: 0.15
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.043186
- TAT(Tat/SPI): 0.000318
- LIPO(Sec/SPII): 0.000919
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446696575 NCBI
- UniProt: see SAUSA300_2465
- protein Genbank : _
- RefSeq: WP_000773921 NCBI
⊟Protein sequence[edit | edit source]
- MKLNNYSLKVKNKQLVDNCDLNFYLGQINHIVGKNGVGKSLLAKDFLLNNSGNIPKSISQNVTLISSSSNIPNDITKDFLLSLLKSKFENNRQTFDKIYNILNIEAIPSNVLLKNLSDGQKQKLKLLSFLLEDHDLIILDEVTNALDKKTVNEIYEFLNDFIQSHQTKTIINITHNLSDLSALPGKYFIFKDLQIEEYQSKEEVINDYINL
⊟Peptides[edit | edit source]
- experimentally validated: data available for NCTC8325
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- sigma factors : _
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.