From AureoWiki
Revision as of 06:44, 11 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS12060 [old locus tag: SAUSA300_2186 ]
  • pan locus tag?: SAUPAN005684000
  • symbol: SAUSA300_RS12060
  • pan gene symbol?: rpmD
  • synonym:
  • product: 50S ribosomal protein L30

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS12060 [old locus tag: SAUSA300_2186 ]
  • symbol: SAUSA300_RS12060
  • product: 50S ribosomal protein L30
  • replicon: chromosome
  • strand: -
  • coordinates: 2362612..2362791
  • length: 180
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGGCTAAATTACAAATTACCCTCACTCGTAGTGTTATTGGTCGTCCTGAAACACAACGT
    AAAACTGTTGAAGCTTTAGGTCTTAAAAAGACTAACAGTTCAGTAGTTGTTGAAGATAAC
    CCTGCTATTCGTGGGCAAATCAACAAAGTTAAGCACTTAGTAACAGTAGAAGAAAAATAA
    60
    120
    180

Protein[edit | edit source]

Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU

General[edit | edit source]

  • locus tag: SAUSA300_RS12060 [old locus tag: SAUSA300_2186 ]
  • symbol: SAUSA300_RS12060
  • description: 50S ribosomal protein L30
  • length: 59
  • theoretical pI: 10.9014
  • theoretical MW: 6553.63
  • GRAVY: -0.4

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL30 (TIGR01308; HMM-score: 96)
    and 1 more
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL30 (TIGR01309; HMM-score: 22.1)
  • TheSEED: see SAUSA300_2186
  • PFAM:
    no clan defined Ribosomal_L30; Ribosomal protein L30p/L7e (PF00327; HMM-score: 77.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.008552
    • TAT(Tat/SPI): 0.00171
    • LIPO(Sec/SPII): 0.001474
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MAKLQITLTRSVIGRPETQRKTVEALGLKKTNSSVVVEDNPAIRGQINKVKHLVTVEEK

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]