Jump to navigation
Jump to search
(Created page with "<protect> <aureodatabase>NCBI date</aureodatabase> =Summary= * <aureodatabase>organism</aureodatabase> * <aureodatabase>locus</aureodatabase> * <aureodatabase>pan locus</aur...") |
m (Text replacement - "gene Genbank" to "gene RefSeq") |
||
Line 39: | Line 39: | ||
* <aureodatabase>gene GI</aureodatabase> | * <aureodatabase>gene GI</aureodatabase> | ||
* <aureodatabase>gene | * <aureodatabase>gene RefSeq</aureodatabase> | ||
</protect> | </protect> | ||
Revision as of 08:26, 11 March 2016
NCBI date : _
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS12035 [old locus tag: SAUSA300_2181 ]
- pan locus tag?: SAUPAN005679000
- symbol: SAUSA300_RS12035
- pan gene symbol?: rpmJ
- synonym:
- product: 50S ribosomal protein L36
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS12035 [old locus tag: SAUSA300_2181 ]
- symbol: SAUSA300_RS12035
- product: 50S ribosomal protein L36
- replicon: chromosome
- strand: -
- coordinates: 2359643..2359756
- length: 114
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: WP_000868342 NCBI
⊟Phenotype[edit | edit source]
- Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61ATGAAAGTAAGACCATCAGTAAAACCTATTTGCGAAAAATGTAAAGTCATTAAACGTAAA
GGTAAAGTAATGGTAATTTGTGAAAATCCAAAACACAAACAAAGACAAGGTTAA60
114
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS12035 [old locus tag: SAUSA300_2181 ]
- symbol: SAUSA300_RS12035
- description: 50S ribosomal protein L36
- length: 37
- theoretical pI: 11.0798
- theoretical MW: 4305.35
- GRAVY: -0.808108
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL36 (TIGR01022; HMM-score: 82.8)
- TheSEED: see SAUSA300_2181
- PFAM: no clan defined Ribosomal_L36; Ribosomal protein L36 (PF00444; HMM-score: 70.2)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- interaction partners:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 10
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.157083
- TAT(Tat/SPI): 0.006832
- LIPO(Sec/SPII): 0.047312
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446791086 NCBI
- UniProt: see SAUSA300_2181
- protein Genbank : _
- RefSeq: WP_000868342 NCBI
⊟Protein sequence[edit | edit source]
- MKVRPSVKPICEKCKVIKRKGKVMVICENPKHKQRQG
⊟Peptides[edit | edit source]
- experimentally validated: data available for NCTC8325
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- sigma factors : _
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.