Jump to navigation
Jump to search
(Created page with "<protect> <aureodatabase>NCBI date</aureodatabase> =Summary= * <aureodatabase>organism</aureodatabase> * <aureodatabase>locus</aureodatabase> * <aureodatabase>pan locus</aur...") |
m (Text replacement - "gene Genbank" to "gene RefSeq") |
||
Line 39: | Line 39: | ||
* <aureodatabase>gene GI</aureodatabase> | * <aureodatabase>gene GI</aureodatabase> | ||
* <aureodatabase>gene | * <aureodatabase>gene RefSeq</aureodatabase> | ||
</protect> | </protect> | ||
Revision as of 04:22, 11 March 2016
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI date : _
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS10765 [old locus tag: SAUSA300_1963 ]
- pan locus tag?: SAUPAN001497000
- symbol: SAUSA300_RS10765
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS10765 [old locus tag: SAUSA300_1963 ]
- symbol: SAUSA300_RS10765
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2120176..2120436
- length: 261
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: WP_001549178 NCBI
⊟Phenotype[edit | edit source]
- Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGACTAAAAATTATAAAGATATGACTCAAGACGAATTAAGGGGTTTATTGGCTGAAAAG
AATGCAGAATTGTTTGATTTAGCGAGCGAAATCGATGAAGAAACTGAATTTGACGTTTTA
CTTTTTTCAAATGTAGGGATTAGCAACGGAGATTTTACACCGTCGTCACATTGTGTGATT
GGGAATGTTGTTGATATTGCTAATTTATTGAAACGTAGAGCTGTTTACCGAGATATCGCT
GATGTTATCAAAATGCGTTAA60
120
180
240
261
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS10765 [old locus tag: SAUSA300_1963 ]
- symbol: SAUSA300_RS10765
- description: hypothetical protein
- length: 86
- theoretical pI: 4.3525
- theoretical MW: 9723.97
- GRAVY: -0.203488
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAUSA300_1963
- PFAM: no clan defined DUF2482; Hypothetical protein of unknown function (DUF2482) (PF10655; HMM-score: 31.4)and 1 moreRibo_L29 (CL0346) Ribosomal_L29; Ribosomal L29 protein (PF00831; HMM-score: 15.1)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- interaction partners:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004604
- TAT(Tat/SPI): 0.000476
- LIPO(Sec/SPII): 0.000478
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 486200488 NCBI
- UniProt: see SAUSA300_1963
- protein Genbank : _
- RefSeq: WP_001549178 NCBI
⊟Protein sequence[edit | edit source]
- MTKNYKDMTQDELRGLLAEKNAELFDLASEIDEETEFDVLLFSNVGISNGDFTPSSHCVIGNVVDIANLLKRRAVYRDIADVIKMR
⊟Peptides[edit | edit source]
- experimentally validated:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- sigma factors : _
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.