NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS10575 [old locus tag: SAUSA300_1927 ]
- pan locus tag?: SAUPAN005044000
- symbol: SAUSA300_RS10575
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS10575 [old locus tag: SAUSA300_1927 ]
- symbol: SAUSA300_RS10575
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2091354..2091506
- length: 153
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (2091354..2091506) NCBI
- BioCyc: see SAUSA300_1927
- MicrobesOnline: see SAUSA300_1927
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGCAGGATAACAAACAAGGATTACAAGCTAATCCTGAATATACAATTCATTATTTATCA
CAGGAAATTATGAGGTTAACACAAGAAAACGCGATGTTAAAAGCGTATATACAAGAAAAT
AAAGAAAATCAACAATGTGCTGAGGAAGAGTAA60
120
153
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS10575 [old locus tag: SAUSA300_1927 ]
- symbol: SAUSA300_RS10575
- description: hypothetical protein
- length: 50
- theoretical pI: 4.21305
- theoretical MW: 5945.55
- GRAVY: -1.208
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAUSA300_1927
- PFAM: no clan defined ZapB; Cell division protein ZapB (PF06005; HMM-score: 15.4)GAG-polyprotein (CL0523) Retrotrans_gag; Retrotransposon gag protein (PF03732; HMM-score: 13)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.018333
- TAT(Tat/SPI): 0.000986
- LIPO(Sec/SPII): 0.00844
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 447076425 NCBI
- RefSeq: WP_001153681 NCBI
- UniProt: see SAUSA300_1927
⊟Protein sequence[edit | edit source]
- MQDNKQGLQANPEYTIHYLSQEIMRLTQENAMLKAYIQENKENQQCAEEE
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.