NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS09380 [old locus tag: SAUSA300_1717 ]
- pan locus tag?: SAUPAN004463000
- symbol: SAUSA300_RS09380
- pan gene symbol?: arsR
- synonym:
- product: transcriptional regulator
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS09380 [old locus tag: SAUSA300_1717 ]
- symbol: SAUSA300_RS09380
- product: transcriptional regulator
- replicon: chromosome
- strand: +
- coordinates: 1900777..1901091
- length: 315
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (1900777..1901091) NCBI
- BioCyc: see SAUSA300_1717
- MicrobesOnline: see SAUSA300_1717
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGACGTATAAAGAACTAGCAACATTTTTAAAAGTTTTATCAGATTCAAGCAGATTAGAA
ATACTAGATTTACTTTCTTGTGGAGAGTTATGCGCTTGTGATTTGTTAGCACATTTTCAA
TTCTCTCAACCTACACTTAGCTATCATATGAAAGCATTAGTAAAAACCAACTTAGTTACG
ACACGAAAAATCGGAAATAAACATTTATACCAGCTCAATCATAATATTTTTGAGTCCGTA
ATTAATAACTTGTCTAAGGTTCATACCTCTAACCAACGATGTATTTGTCATAACCTTAAG
ACTGGTGAATGCTAA60
120
180
240
300
315
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS09380 [old locus tag: SAUSA300_1717 ]
- symbol: SAUSA300_RS09380
- description: transcriptional regulator
- length: 104
- theoretical pI: 8.38639
- theoretical MW: 11840.7
- GRAVY: -0.0778846
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 11.8)
- TheSEED: see SAUSA300_1717
- PFAM: HTH (CL0123) HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 55.6)and 4 moreHTH_20; Helix-turn-helix domain (PF12840; HMM-score: 42)MarR_2; MarR family (PF12802; HMM-score: 17)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 13.5)MarR; MarR family (PF01047; HMM-score: 12.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- genes regulated by ArsR, TF important in Arsenic resistance: see SAUSA300_1717
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.025855
- TAT(Tat/SPI): 0.003566
- LIPO(Sec/SPII): 0.067076
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446143324 NCBI
- RefSeq: WP_000221179 NCBI
- UniProt: see SAUSA300_1717
⊟Protein sequence[edit | edit source]
- MTYKELATFLKVLSDSSRLEILDLLSCGELCACDLLAHFQFSQPTLSYHMKALVKTNLVTTRKIGNKHLYQLNHNIFESVINNLSKVHTSNQRCICHNLKTGEC
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: ArsR see SAUSA300_1717
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.