Jump to navigation
Jump to search
m (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "") |
m (Text replacement - "gene Genbank" to "gene RefSeq") |
||
Line 1: | Line 1: | ||
__TOC__ | |||
<protect> | <protect> | ||
<aureodatabase> | <aureodatabase>annotation</aureodatabase> | ||
=Summary= | =Summary= | ||
* <aureodatabase>organism</aureodatabase> | *<aureodatabase>organism</aureodatabase> | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>pan locus</aureodatabase> | *<aureodatabase>pan locus</aureodatabase> | ||
* <aureodatabase>gene symbol</aureodatabase> | *<aureodatabase>gene symbol</aureodatabase> | ||
* <aureodatabase>pan gene symbol</aureodatabase> | *<aureodatabase>pan gene symbol</aureodatabase> | ||
* <aureodatabase>gene synonyms</aureodatabase> | *<aureodatabase>gene synonyms</aureodatabase> | ||
* <aureodatabase>product</aureodatabase> | *<aureodatabase>product</aureodatabase> | ||
</protect> | </protect> | ||
Line 24: | Line 25: | ||
==General== | ==General== | ||
* <aureodatabase>gene type</aureodatabase> | *<aureodatabase>gene type</aureodatabase> | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>gene symbol</aureodatabase> | *<aureodatabase>gene symbol</aureodatabase> | ||
* <aureodatabase>product</aureodatabase> | *<aureodatabase>product</aureodatabase> | ||
* <aureodatabase>gene replicon</aureodatabase> | *<aureodatabase>gene replicon</aureodatabase> | ||
* <aureodatabase>strand</aureodatabase> | *<aureodatabase>strand</aureodatabase> | ||
* <aureodatabase>gene coordinates</aureodatabase> | *<aureodatabase>gene coordinates</aureodatabase> | ||
* <aureodatabase>gene length</aureodatabase> | *<aureodatabase>gene length</aureodatabase> | ||
* <aureodatabase>essential</aureodatabase> | *<aureodatabase>essential</aureodatabase> | ||
*<aureodatabase>gene comment</aureodatabase> | |||
</protect> | </protect> | ||
Line 38: | Line 40: | ||
==Accession numbers== | ==Accession numbers== | ||
* <aureodatabase>gene | *<aureodatabase>gene location</aureodatabase> | ||
* <aureodatabase>gene | *<aureodatabase>gene BioCyc</aureodatabase> | ||
*<aureodatabase>gene MicrobesOnline</aureodatabase> | |||
</protect> | </protect> | ||
<protect> | <protect> | ||
==Phenotype== | ==Phenotype== | ||
</protect> | </protect> | ||
Share your knowledge and add information here. [<span class="plainlinks">[//aureowiki.med.uni-greifswald.de/index.php?title={{PAGENAMEE}}&veaction=edit§ion=6 edit]</span>] | |||
<protect> | <protect> | ||
==DNA sequence== | ==DNA sequence== | ||
* <aureodatabase>gene sequence</aureodatabase> | *<aureodatabase>gene sequence</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
<aureodatabase>RNA regulated operons</aureodatabase> | |||
</protect> | |||
<protect> | |||
=Protein= | =Protein= | ||
<aureodatabase>protein 3D view</aureodatabase> | <aureodatabase>protein 3D view</aureodatabase> | ||
==General== | ==General== | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>protein symbol</aureodatabase> | *<aureodatabase>protein symbol</aureodatabase> | ||
* <aureodatabase>protein description</aureodatabase> | *<aureodatabase>protein description</aureodatabase> | ||
* <aureodatabase>protein length</aureodatabase> | *<aureodatabase>protein length</aureodatabase> | ||
* <aureodatabase>theoretical pI</aureodatabase> | *<aureodatabase>theoretical pI</aureodatabase> | ||
* <aureodatabase>theoretical MW</aureodatabase> | *<aureodatabase>theoretical MW</aureodatabase> | ||
* <aureodatabase>GRAVY</aureodatabase> | *<aureodatabase>GRAVY</aureodatabase> | ||
</protect> | </protect> | ||
Line 71: | Line 77: | ||
==Function== | ==Function== | ||
* <aureodatabase>protein reaction</aureodatabase> | *<aureodatabase>protein reaction</aureodatabase> | ||
* <aureodatabase>protein TIGRFAM</aureodatabase> | *<aureodatabase>protein TIGRFAM</aureodatabase> | ||
* <aureodatabase>protein TheSeed</aureodatabase> | *<aureodatabase>protein TheSeed</aureodatabase> | ||
* <aureodatabase>protein PFAM</aureodatabase> | *<aureodatabase>protein PFAM</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
==Structure, modifications & | ==Structure, modifications & cofactors== | ||
* <aureodatabase>protein domains</aureodatabase> | *<aureodatabase>protein domains</aureodatabase> | ||
* <aureodatabase>protein modifications</aureodatabase> | *<aureodatabase>protein modifications</aureodatabase> | ||
* <aureodatabase>protein cofactors</aureodatabase> | *<aureodatabase>protein cofactors</aureodatabase> | ||
* <aureodatabase>protein effectors</aureodatabase> | *<aureodatabase>protein effectors</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein regulated operons</aureodatabase> | ||
</protect> | </protect> | ||
Line 90: | Line 96: | ||
==Localization== | ==Localization== | ||
* <aureodatabase>protein Psortb</aureodatabase> | *<aureodatabase>protein Psortb</aureodatabase> | ||
* <aureodatabase>protein LocateP</aureodatabase> | *<aureodatabase>protein LocateP</aureodatabase> | ||
* <aureodatabase>protein SignalP</aureodatabase> | *<aureodatabase>protein SignalP</aureodatabase> | ||
* <aureodatabase>protein TMHMM</aureodatabase> | *<aureodatabase>protein TMHMM</aureodatabase> | ||
</protect> | </protect> | ||
Line 99: | Line 105: | ||
==Accession numbers== | ==Accession numbers== | ||
* <aureodatabase>protein GI</aureodatabase> | *<aureodatabase>protein GI</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein RefSeq</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein UniProt</aureodatabase> | ||
</protect> | </protect> | ||
Line 107: | Line 113: | ||
==Protein sequence== | ==Protein sequence== | ||
* <aureodatabase>protein sequence</aureodatabase> | *<aureodatabase>protein sequence</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
== | ==Experimental data== | ||
* <aureodatabase>protein validated peptides</aureodatabase> | *<aureodatabase>protein validated peptides</aureodatabase> | ||
*<aureodatabase>protein validated localization</aureodatabase> | |||
*<aureodatabase>protein validated quantitative data</aureodatabase> | |||
*<aureodatabase>protein partners</aureodatabase> | |||
</protect> | </protect> | ||
Line 124: | Line 133: | ||
==Operon== | ==Operon== | ||
* <aureodatabase>operons</aureodatabase> | *<aureodatabase>operons</aureodatabase> | ||
</protect> | </protect> | ||
Line 130: | Line 139: | ||
==Regulation== | ==Regulation== | ||
*<aureodatabase>regulators</aureodatabase> | |||
* <aureodatabase>regulators</aureodatabase> | |||
</protect> | </protect> | ||
Line 137: | Line 145: | ||
==Transcription pattern== | ==Transcription pattern== | ||
* <aureodatabase>expression browser</aureodatabase> | *<aureodatabase>expression browser</aureodatabase> | ||
</protect> | </protect> | ||
Line 143: | Line 151: | ||
==Protein synthesis (provided by Aureolib)== | ==Protein synthesis (provided by Aureolib)== | ||
* <aureodatabase>protein synthesis Aureolib</aureodatabase> | *<aureodatabase>protein synthesis Aureolib</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
== | ==Protein stability== | ||
* <aureodatabase>protein half-life</aureodatabase> | *<aureodatabase>protein half-life</aureodatabase> | ||
</protect> | </protect> | ||
Latest revision as of 08:27, 11 March 2016
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS08135 [old locus tag: SAUSA300_1490 ]
- pan locus tag?: SAUPAN004106000
- symbol: SAUSA300_RS08135
- pan gene symbol?: efp
- synonym:
- product: elongation factor P
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS08135 [old locus tag: SAUSA300_1490 ]
- symbol: SAUSA300_RS08135
- product: elongation factor P
- replicon: chromosome
- strand: -
- coordinates: 1644418..1644975
- length: 558
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (1644418..1644975) NCBI
- BioCyc: see SAUSA300_1490
- MicrobesOnline: see SAUSA300_1490
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541ATGATTTCGGTTAATGATTTTAAAACAGGTTTAACAATTTCTGTTGATAACGCTATTTGG
AAAGTTATAGACTTCCAACATGTAAAGCCTGGTAAAGGTTCAGCATTCGTTCGTTCAAAA
TTACGTAATTTAAGAACTGGTGCAATTCAAGAGAAAACGTTTAGAGCTGGTGAAAAAGTT
GAACCAGCAATGATTGAAAATCGTCGCATGCAATATTTATATGCTGACGGAGATAATCAT
GTATTTATGGATAATGAAAGCTTTGAACAAACAGAACTTTCAAGTGATTACTTAAAAGAA
GAATTGAATTACTTAAAAGAAGGTATGGAAGTACAAATTCAAACATACGAAGGTGAAACT
ATCGGTGTTGAATTACCTAAAACTGTTGAATTAACAGTAACTGAAACAGAACCTGGTATT
AAAGGTGATACTGCAACTGGTGCCACTAAATCGGCAACTGTTGAAACTGGTTATACATTA
AATGTACCTTTATTTGTAAACGAAGGTGACGTTTTAATTATCAACACTGGTGATGGAAGC
TACATTTCAAGAGGATAA60
120
180
240
300
360
420
480
540
558
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS08135 [old locus tag: SAUSA300_1490 ]
- symbol: SAUSA300_RS08135
- description: elongation factor P
- length: 185
- theoretical pI: 4.46265
- theoretical MW: 20553.9
- GRAVY: -0.41027
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Translation factors translation elongation factor P (TIGR00038; HMM-score: 265.8)and 2 moreProtein synthesis Translation factors elongation factor P-like protein YeiP (TIGR02178; HMM-score: 127.2)Protein synthesis Translation factors translation elongation factor IF5A (TIGR00037; HMM-score: 22.7)
- TheSEED: see SAUSA300_1490
- PFAM: KOW (CL0107) EFP_N; Elongation factor P (EF-P) KOW-like domain (PF08207; HMM-score: 96.5)OB (CL0021) Elong-fact-P_C; Elongation factor P, C-terminal (PF09285; HMM-score: 90.7)EFP; Elongation factor P (EF-P) OB domain (PF01132; HMM-score: 82.6)and 1 moreno clan defined SMC_Nse1; Nse1 non-SMC component of SMC5-6 complex (PF07574; HMM-score: 15)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 10
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002655
- TAT(Tat/SPI): 0.000227
- LIPO(Sec/SPII): 0.00036
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446549158 NCBI
- RefSeq: WP_000626504 NCBI
- UniProt: see SAUSA300_1490
⊟Protein sequence[edit | edit source]
- MISVNDFKTGLTISVDNAIWKVIDFQHVKPGKGSAFVRSKLRNLRTGAIQEKTFRAGEKVEPAMIENRRMQYLYADGDNHVFMDNESFEQTELSSDYLKEELNYLKEGMEVQIQTYEGETIGVELPKTVELTVTETEPGIKGDTATGATKSATVETGYTLNVPLFVNEGDVLIINTGDGSYISRG
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SAUSA300_RS07335 (asnC) asparagine--tRNA ligase [1] (data from MRSA252) SAUSA300_RS11505 (deoA) pyrimidine-nucleoside phosphorylase [1] (data from MRSA252) SAUSA300_RS10295 (gatA) glutamyl-tRNA(Gln) amidotransferase subunit A [1] (data from MRSA252) SAUSA300_RS06275 (nusA) transcription termination/antitermination protein NusA [1] (data from MRSA252) SAUSA300_RS00015 DNA polymerase III subunit beta [1] (data from MRSA252) SAUSA300_RS00050 serine--tRNA ligase [1] (data from MRSA252) SAUSA300_RS00080 50S ribosomal protein L9 [1] (data from MRSA252) SAUSA300_RS00585 peptidoglycan-binding protein LysM [1] (data from MRSA252) SAUSA300_RS01155 formate acetyltransferase [1] (data from MRSA252) SAUSA300_RS01250 L-lactate dehydrogenase [1] (data from MRSA252) SAUSA300_RS01330 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [1] (data from MRSA252) SAUSA300_RS01885 acetyl-CoA acyltransferase [1] (data from MRSA252) SAUSA300_RS01930 GTP-binding protein YchF [1] (data from MRSA252) SAUSA300_RS01940 30S ribosomal protein S6 [1] (data from MRSA252) SAUSA300_RS02055 hypothetical protein [1] (data from MRSA252) SAUSA300_RS02070 IMP dehydrogenase [1] (data from MRSA252) SAUSA300_RS02425 YbaB/EbfC family nucleoid-associated protein [1] (data from MRSA252) SAUSA300_RS02540 pur operon repressor [1] (data from MRSA252) SAUSA300_RS02550 stage V sporulation protein G [1] (data from MRSA252) SAUSA300_RS02575 50S ribosomal protein L25/general stress protein Ctc [1] (data from MRSA252) SAUSA300_RS02610 RNA-binding protein S1 [1] (data from MRSA252) SAUSA300_RS02630 redox-regulated molecular chaperone Hsp33 [1] (data from MRSA252) SAUSA300_RS02635 cysteine synthase [1] (data from MRSA252) SAUSA300_RS02700 pyridoxal 5'-phosphate synthase lyase subunit PdxS [1] (data from MRSA252) SAUSA300_RS02750 glutamate--tRNA ligase [1] (data from MRSA252) SAUSA300_RS02790 transcription termination/antitermination protein NusG [1] (data from MRSA252) SAUSA300_RS02795 50S ribosomal protein L11 [1] (data from MRSA252) SAUSA300_RS02800 50S ribosomal protein L1 [1] (data from MRSA252) SAUSA300_RS02805 50S ribosomal protein L10 [1] (data from MRSA252) SAUSA300_RS02810 50S ribosomal protein L7/L12 [1] (data from MRSA252) SAUSA300_RS02820 DNA-directed RNA polymerase subunit beta [1] (data from MRSA252) SAUSA300_RS02825 DNA-directed RNA polymerase subunit beta' [1] (data from MRSA252) SAUSA300_RS02835 30S ribosomal protein S12 [1] (data from MRSA252) SAUSA300_RS02840 30S ribosomal protein S7 [1] (data from MRSA252) SAUSA300_RS02845 elongation factor G [1] (data from MRSA252) SAUSA300_RS02850 elongation factor Tu [1] (data from MRSA252) SAUSA300_RS02860 2-amino-3-ketobutyrate CoA ligase [1] (data from MRSA252) SAUSA300_RS02880 branched chain amino acid aminotransferase [1] (data from MRSA252) SAUSA300_RS02960 3-hexulose-6-phosphate synthase [1] (data from MRSA252) SAUSA300_RS03050 phosphate acetyltransferase [1] (data from MRSA252) SAUSA300_RS03190 zinc-dependent alcohol dehydrogenase [1] (data from MRSA252) SAUSA300_RS03205 arginine--tRNA ligase [1] (data from MRSA252) SAUSA300_RS03410 dihydroxyacetone kinase subunit DhaK [1] (data from MRSA252) SAUSA300_RS03480 hypothetical protein [1] (data from MRSA252) SAUSA300_RS03510 transcriptional regulator [1] (data from MRSA252) SAUSA300_RS03605 MarR family transcriptional regulator [1] (data from MRSA252) SAUSA300_RS03720 hypothetical protein [1] (data from MRSA252) SAUSA300_RS03960 ribosomal subunit interface protein [1] (data from MRSA252) SAUSA300_RS04060 ATP-dependent Clp protease proteolytic subunit [1] (data from MRSA252) SAUSA300_RS04080 aldehyde dehydrogenase [1] (data from MRSA252) SAUSA300_RS04085 phosphoglycerate kinase [1] (data from MRSA252) SAUSA300_RS04090 triose-phosphate isomerase [1] (data from MRSA252) SAUSA300_RS04095 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [1] (data from MRSA252) SAUSA300_RS04100 enolase [1] (data from MRSA252) SAUSA300_RS04190 cold-shock protein [1] (data from MRSA252) SAUSA300_RS04270 glycine cleavage system protein H [1] (data from MRSA252) SAUSA300_RS04415 Fe-S cluster assembly protein SufD [1] (data from MRSA252) SAUSA300_RS04430 Fe-S cluster assembly protein SufB [1] (data from MRSA252) SAUSA300_RS04515 D-alanine--poly(phosphoribitol) ligase [1] (data from MRSA252) SAUSA300_RS04560 NADH dehydrogenase [1] (data from MRSA252) SAUSA300_RS04645 NAD-specific glutamate dehydrogenase [1] (data from MRSA252) SAUSA300_RS04670 glucose-6-phosphate isomerase [1] (data from MRSA252) SAUSA300_RS04710 CoA-disulfide reductase [1] (data from MRSA252) SAUSA300_RS04775 beta-ketoacyl-[acyl-carrier-protein] synthase II [1] (data from MRSA252) SAUSA300_RS04855 oligoendopeptidase F [1] (data from MRSA252) SAUSA300_RS04905 enoyl-ACP reductase [1] (data from MRSA252) SAUSA300_RS04925 hypothetical protein [1] (data from MRSA252) SAUSA300_RS05190 bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase [1] (data from MRSA252) SAUSA300_RS05290 phosphocarrier protein HPr [1] (data from MRSA252) SAUSA300_RS05295 phosphoenolpyruvate--protein phosphotransferase [1] (data from MRSA252) SAUSA300_RS05330 hypothetical protein [1] (data from MRSA252) SAUSA300_RS05350 pyruvate dehydrogenase E1 component subunit alpha [1] (data from MRSA252) SAUSA300_RS05360 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex [1] (data from MRSA252) SAUSA300_RS05430 translational GTPase TypA [1] (data from MRSA252) SAUSA300_RS05620 thiol reductase thioredoxin [1] (data from MRSA252) SAUSA300_RS05855 cell division protein FtsZ [1] (data from MRSA252) SAUSA300_RS05890 isoleucine--tRNA ligase [1] (data from MRSA252) SAUSA300_RS06080 beta-ketoacyl-ACP reductase [1] (data from MRSA252) SAUSA300_RS06120 30S ribosomal protein S16 [1] (data from MRSA252) SAUSA300_RS06135 50S ribosomal protein L19 [1] (data from MRSA252) SAUSA300_RS06165 succinyl-CoA ligase subunit alpha [1] (data from MRSA252) SAUSA300_RS06210 GTP-sensing pleiotropic transcriptional regulator CodY [1] (data from MRSA252) SAUSA300_RS06220 30S ribosomal protein S2 [1] (data from MRSA252) SAUSA300_RS06230 elongation factor Ts [1] (data from MRSA252) SAUSA300_RS06240 ribosome-recycling factor [1] (data from MRSA252) SAUSA300_RS06290 translation initiation factor IF-2 [1] (data from MRSA252) SAUSA300_RS06310 30S ribosomal protein S15 [1] (data from MRSA252) SAUSA300_RS06315 polyribonucleotide nucleotidyltransferase [1] (data from MRSA252) SAUSA300_RS06485 glutamine synthetase [1] (data from MRSA252) SAUSA300_RS06680 catalase [1] (data from MRSA252) SAUSA300_RS06725 transketolase [1] (data from MRSA252) SAUSA300_RS06765 aconitate hydratase [1] (data from MRSA252) SAUSA300_RS06985 ABC transporter ATP-binding protein [1] (data from MRSA252) SAUSA300_RS07105 2-oxoglutarate dehydrogenase E1 component [1] (data from MRSA252) SAUSA300_RS07145 N-acetyltransferase [1] (data from MRSA252) SAUSA300_RS07255 alanine dehydrogenase [1] (data from MRSA252) SAUSA300_RS07430 DNA-binding protein HU [1] (data from MRSA252) SAUSA300_RS07445 30S ribosomal protein S1 [1] (data from MRSA252) SAUSA300_RS07970 phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating) [1] (data from MRSA252) SAUSA300_RS08140 peptidase M24 family protein [1] (data from MRSA252) SAUSA300_RS08170 glycine dehydrogenase [1] (data from MRSA252) SAUSA300_RS08260 superoxide dismutase [1] (data from MRSA252) SAUSA300_RS08395 molecular chaperone DnaK [1] (data from MRSA252) SAUSA300_RS08425 30S ribosomal protein S20 [1] (data from MRSA252) SAUSA300_RS08720 50S ribosomal protein L27 [1] (data from MRSA252) SAUSA300_RS08730 50S ribosomal protein L21 [1] (data from MRSA252) SAUSA300_RS08840 trigger factor [1] (data from MRSA252) SAUSA300_RS08885 threonine--tRNA ligase [1] (data from MRSA252) SAUSA300_RS08910 aldehyde dehydrogenase [1] (data from MRSA252) SAUSA300_RS08950 isocitrate dehydrogenase (NADP(+)) [1] (data from MRSA252) SAUSA300_RS08975 pyruvate kinase [1] (data from MRSA252) SAUSA300_RS08980 ATP-dependent 6-phosphofructokinase [1] (data from MRSA252) SAUSA300_RS08995 NAD-dependent malic enzyme 4 [1] (data from MRSA252) SAUSA300_RS09015 universal stress protein [1] (data from MRSA252) SAUSA300_RS09025 dipeptidase [1] (data from MRSA252) SAUSA300_RS09040 universal stress protein UspA [1] (data from MRSA252) SAUSA300_RS09045 acetate kinase [1] (data from MRSA252) SAUSA300_RS09090 30S ribosomal protein S4 [1] (data from MRSA252) SAUSA300_RS09165 formate--tetrahydrofolate ligase [1] (data from MRSA252) SAUSA300_RS09265 D-alanine aminotransferase [1] (data from MRSA252) SAUSA300_RS09270 dipeptidase PepV [1] (data from MRSA252) SAUSA300_RS09305 leucine--tRNA ligase [1] (data from MRSA252) SAUSA300_RS09425 transaldolase [1] (data from MRSA252) SAUSA300_RS09465 S-adenosylmethionine synthase [1] (data from MRSA252) SAUSA300_RS09470 phosphoenolpyruvate carboxykinase (ATP) [1] (data from MRSA252) SAUSA300_RS09770 signal transduction protein TRAP [1] (data from MRSA252) SAUSA300_RS09875 glucosamine-6-phosphate isomerase [1] (data from MRSA252) SAUSA300_RS10140 glutamine amidotransferase [1] (data from MRSA252) SAUSA300_RS10205 methionine aminopeptidase [1] (data from MRSA252) SAUSA300_RS10250 non-heme ferritin [1] (data from MRSA252) SAUSA300_RS10400 manganese-dependent inorganic pyrophosphatase [1] (data from MRSA252) SAUSA300_RS10450 thioredoxin family protein [1] (data from MRSA252) SAUSA300_RS10900 molecular chaperone GroEL [1] (data from MRSA252) SAUSA300_RS10905 co-chaperone GroES [1] (data from MRSA252) SAUSA300_RS11220 D-alanine--D-alanine ligase [1] (data from MRSA252) SAUSA300_RS11315 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [1] (data from MRSA252) SAUSA300_RS11380 uracil phosphoribosyltransferase [1] (data from MRSA252) SAUSA300_RS11420 50S ribosomal protein L31 type B [1] (data from MRSA252) SAUSA300_RS11440 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [1] (data from MRSA252) SAUSA300_RS11445 fructose-bisphosphate aldolase [1] (data from MRSA252) SAUSA300_RS11455 CTP synthetase [1] (data from MRSA252) SAUSA300_RS11460 DNA-directed RNA polymerase subunit delta [1] (data from MRSA252) SAUSA300_RS11520 purine-nucleoside phosphorylase [1] (data from MRSA252) SAUSA300_RS11600 glutamine--fructose-6-phosphate aminotransferase [1] (data from MRSA252) SAUSA300_RS11740 hypothetical protein [1] (data from MRSA252) SAUSA300_RS11805 Asp23/Gls24 family envelope stress response protein [1] (data from MRSA252) SAUSA300_RS11985 30S ribosomal protein S9 [1] (data from MRSA252) SAUSA300_RS11990 50S ribosomal protein L13 [1] (data from MRSA252) SAUSA300_RS12015 50S ribosomal protein L17 [1] (data from MRSA252) SAUSA300_RS12020 DNA-directed RNA polymerase subunit alpha [1] (data from MRSA252) SAUSA300_RS12025 30S ribosomal protein S11 [1] (data from MRSA252) SAUSA300_RS12030 30S ribosomal protein S13 [1] (data from MRSA252) SAUSA300_RS12045 adenylate kinase [1] (data from MRSA252) SAUSA300_RS12065 30S ribosomal protein S5 [1] (data from MRSA252) SAUSA300_RS12075 50S ribosomal protein L6 [1] (data from MRSA252) SAUSA300_RS12080 30S ribosomal protein S8 [1] (data from MRSA252) SAUSA300_RS12090 50S ribosomal protein L5 [1] (data from MRSA252) SAUSA300_RS12095 50S ribosomal protein L24 [1] (data from MRSA252) SAUSA300_RS12105 30S ribosomal protein S17 [1] (data from MRSA252) SAUSA300_RS12115 50S ribosomal protein L16 [1] (data from MRSA252) SAUSA300_RS12120 30S ribosomal protein S3 [1] (data from MRSA252) SAUSA300_RS12125 50S ribosomal protein L22 [1] (data from MRSA252) SAUSA300_RS12135 50S ribosomal protein L2 [1] (data from MRSA252) SAUSA300_RS12140 50S ribosomal protein L23 [1] (data from MRSA252) SAUSA300_RS12145 50S ribosomal protein L4 [1] (data from MRSA252) SAUSA300_RS12155 30S ribosomal protein S10 [1] (data from MRSA252) SAUSA300_RS12450 2-hydroxyacid dehydrogenase [1] (data from MRSA252) SAUSA300_RS13045 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [1] (data from MRSA252) SAUSA300_RS13615 fructose 1,6-bisphosphatase [1] (data from MRSA252) SAUSA300_RS13660 lactate dehydrogenase [1] (data from MRSA252) SAUSA300_RS13795 hydroxymethylglutaryl-CoA synthase [1] (data from MRSA252) SAUSA300_RS13840 L-glutamate gamma-semialdehyde dehydrogenase [1] (data from MRSA252) SAUSA300_RS14060 3-methyl-2-oxobutanoate hydroxymethyltransferase [1] (data from MRSA252) SAUSA300_RS14075 L-lactate dehydrogenase [1] (data from MRSA252) SAUSA300_RS14100 class I fructose-bisphosphate aldolase [1] (data from MRSA252) SAUSA300_RS14105 malate:quinone oxidoreductase [1] (data from MRSA252) SAUSA300_RS14290 ornithine carbamoyltransferase [1] (data from MRSA252) SAUSA300_RS14295 arginine deiminase [1] (data from MRSA252) SAUSA300_RS14335 mannose-6-phosphate isomerase, class I [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.000 1.001 1.002 1.003 1.004 1.005 1.006 1.007 1.008 1.009 1.010 1.011 1.012 1.013 1.014 1.015 1.016 1.017 1.018 1.019 1.020 1.021 1.022 1.023 1.024 1.025 1.026 1.027 1.028 1.029 1.030 1.031 1.032 1.033 1.034 1.035 1.036 1.037 1.038 1.039 1.040 1.041 1.042 1.043 1.044 1.045 1.046 1.047 1.048 1.049 1.050 1.051 1.052 1.053 1.054 1.055 1.056 1.057 1.058 1.059 1.060 1.061 1.062 1.063 1.064 1.065 1.066 1.067 1.068 1.069 1.070 1.071 1.072 1.073 1.074 1.075 1.076 1.077 1.078 1.079 1.080 1.081 1.082 1.083 1.084 1.085 1.086 1.087 1.088 1.089 1.090 1.091 1.092 1.093 1.094 1.095 1.096 1.097 1.098 1.099 1.100 1.101 1.102 1.103 1.104 1.105 1.106 1.107 1.108 1.109 1.110 1.111 1.112 1.113 1.114 1.115 1.116 1.117 1.118 1.119 1.120 1.121 1.122 1.123 1.124 1.125 1.126 1.127 1.128 1.129 1.130 1.131 1.132 1.133 1.134 1.135 1.136 1.137 1.138 1.139 1.140 1.141 1.142 1.143 1.144 1.145 1.146 1.147 1.148 1.149 1.150 1.151 1.152 1.153 1.154 1.155 1.156 1.157 1.158 1.159 1.160 1.161 1.162 1.163 1.164 1.165 1.166 1.167 1.168 1.169 1.170 1.171 1.172 1.173 1.174 1.175 1.176 1.177 1.178 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)