Jump to navigation
Jump to search
(Created page with "<protect> <aureodatabase>NCBI date</aureodatabase> =Summary= * <aureodatabase>organism</aureodatabase> * <aureodatabase>locus</aureodatabase> * <aureodatabase>pan locus</aur...") |
m (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "") |
||
(One intermediate revision by the same user not shown) | |||
Line 1: | Line 1: | ||
__TOC__ | |||
<protect> | <protect> | ||
<aureodatabase> | <aureodatabase>annotation</aureodatabase> | ||
=Summary= | =Summary= | ||
* <aureodatabase>organism</aureodatabase> | *<aureodatabase>organism</aureodatabase> | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>pan locus</aureodatabase> | *<aureodatabase>pan locus</aureodatabase> | ||
* <aureodatabase>gene symbol</aureodatabase> | *<aureodatabase>gene symbol</aureodatabase> | ||
* <aureodatabase>pan gene symbol</aureodatabase> | *<aureodatabase>pan gene symbol</aureodatabase> | ||
* <aureodatabase>gene synonyms</aureodatabase> | *<aureodatabase>gene synonyms</aureodatabase> | ||
* <aureodatabase>product</aureodatabase> | *<aureodatabase>product</aureodatabase> | ||
</protect> | </protect> | ||
Line 24: | Line 25: | ||
==General== | ==General== | ||
* <aureodatabase>gene type</aureodatabase> | *<aureodatabase>gene type</aureodatabase> | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>gene symbol</aureodatabase> | *<aureodatabase>gene symbol</aureodatabase> | ||
* <aureodatabase>product</aureodatabase> | *<aureodatabase>product</aureodatabase> | ||
* <aureodatabase>gene replicon</aureodatabase> | *<aureodatabase>gene replicon</aureodatabase> | ||
* <aureodatabase>strand</aureodatabase> | *<aureodatabase>strand</aureodatabase> | ||
* <aureodatabase>gene coordinates</aureodatabase> | *<aureodatabase>gene coordinates</aureodatabase> | ||
* <aureodatabase>gene length</aureodatabase> | *<aureodatabase>gene length</aureodatabase> | ||
* <aureodatabase>essential</aureodatabase> | *<aureodatabase>essential</aureodatabase> | ||
*<aureodatabase>gene comment</aureodatabase> | |||
</protect> | </protect> | ||
Line 38: | Line 40: | ||
==Accession numbers== | ==Accession numbers== | ||
* <aureodatabase>gene | *<aureodatabase>gene location</aureodatabase> | ||
* <aureodatabase>gene | *<aureodatabase>gene BioCyc</aureodatabase> | ||
*<aureodatabase>gene MicrobesOnline</aureodatabase> | |||
</protect> | </protect> | ||
<protect> | <protect> | ||
==Phenotype== | ==Phenotype== | ||
</protect> | </protect> | ||
Share your knowledge and add information here. [<span class="plainlinks">[//aureowiki.med.uni-greifswald.de/index.php?title={{PAGENAMEE}}&veaction=edit§ion=6 edit]</span>] | |||
<protect> | <protect> | ||
==DNA sequence== | ==DNA sequence== | ||
* <aureodatabase>gene sequence</aureodatabase> | *<aureodatabase>gene sequence</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
<aureodatabase>RNA regulated operons</aureodatabase> | |||
</protect> | |||
<protect> | |||
=Protein= | =Protein= | ||
<aureodatabase>protein 3D view</aureodatabase> | <aureodatabase>protein 3D view</aureodatabase> | ||
==General== | ==General== | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>protein symbol</aureodatabase> | *<aureodatabase>protein symbol</aureodatabase> | ||
* <aureodatabase>protein description</aureodatabase> | *<aureodatabase>protein description</aureodatabase> | ||
* <aureodatabase>protein length</aureodatabase> | *<aureodatabase>protein length</aureodatabase> | ||
* <aureodatabase>theoretical pI</aureodatabase> | *<aureodatabase>theoretical pI</aureodatabase> | ||
* <aureodatabase>theoretical MW</aureodatabase> | *<aureodatabase>theoretical MW</aureodatabase> | ||
* <aureodatabase>GRAVY</aureodatabase> | *<aureodatabase>GRAVY</aureodatabase> | ||
</protect> | </protect> | ||
Line 71: | Line 77: | ||
==Function== | ==Function== | ||
* <aureodatabase>protein reaction</aureodatabase> | *<aureodatabase>protein reaction</aureodatabase> | ||
* <aureodatabase>protein TIGRFAM</aureodatabase> | *<aureodatabase>protein TIGRFAM</aureodatabase> | ||
* <aureodatabase>protein TheSeed</aureodatabase> | *<aureodatabase>protein TheSeed</aureodatabase> | ||
* <aureodatabase>protein PFAM</aureodatabase> | *<aureodatabase>protein PFAM</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
==Structure, modifications & | ==Structure, modifications & cofactors== | ||
* <aureodatabase>protein domains</aureodatabase> | *<aureodatabase>protein domains</aureodatabase> | ||
* <aureodatabase>protein modifications</aureodatabase> | *<aureodatabase>protein modifications</aureodatabase> | ||
* <aureodatabase>protein cofactors</aureodatabase> | *<aureodatabase>protein cofactors</aureodatabase> | ||
* <aureodatabase>protein effectors</aureodatabase> | *<aureodatabase>protein effectors</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein regulated operons</aureodatabase> | ||
</protect> | </protect> | ||
Line 90: | Line 96: | ||
==Localization== | ==Localization== | ||
* <aureodatabase>protein Psortb</aureodatabase> | *<aureodatabase>protein Psortb</aureodatabase> | ||
* <aureodatabase>protein LocateP</aureodatabase> | *<aureodatabase>protein LocateP</aureodatabase> | ||
* <aureodatabase>protein SignalP</aureodatabase> | *<aureodatabase>protein SignalP</aureodatabase> | ||
* <aureodatabase>protein TMHMM</aureodatabase> | *<aureodatabase>protein TMHMM</aureodatabase> | ||
</protect> | </protect> | ||
Line 99: | Line 105: | ||
==Accession numbers== | ==Accession numbers== | ||
* <aureodatabase>protein GI</aureodatabase> | *<aureodatabase>protein GI</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein RefSeq</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein UniProt</aureodatabase> | ||
</protect> | </protect> | ||
Line 108: | Line 113: | ||
==Protein sequence== | ==Protein sequence== | ||
* <aureodatabase>protein sequence</aureodatabase> | *<aureodatabase>protein sequence</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
== | ==Experimental data== | ||
* <aureodatabase>protein validated peptides</aureodatabase> | *<aureodatabase>protein validated peptides</aureodatabase> | ||
*<aureodatabase>protein validated localization</aureodatabase> | |||
*<aureodatabase>protein validated quantitative data</aureodatabase> | |||
*<aureodatabase>protein partners</aureodatabase> | |||
</protect> | </protect> | ||
Line 125: | Line 133: | ||
==Operon== | ==Operon== | ||
* <aureodatabase>operons</aureodatabase> | *<aureodatabase>operons</aureodatabase> | ||
</protect> | </protect> | ||
Line 131: | Line 139: | ||
==Regulation== | ==Regulation== | ||
*<aureodatabase>regulators</aureodatabase> | |||
* <aureodatabase>regulators</aureodatabase> | |||
</protect> | </protect> | ||
Line 138: | Line 145: | ||
==Transcription pattern== | ==Transcription pattern== | ||
* <aureodatabase>expression browser</aureodatabase> | *<aureodatabase>expression browser</aureodatabase> | ||
</protect> | </protect> | ||
Line 144: | Line 151: | ||
==Protein synthesis (provided by Aureolib)== | ==Protein synthesis (provided by Aureolib)== | ||
* <aureodatabase>protein synthesis Aureolib</aureodatabase> | *<aureodatabase>protein synthesis Aureolib</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
== | ==Protein stability== | ||
* <aureodatabase>protein half-life</aureodatabase> | *<aureodatabase>protein half-life</aureodatabase> | ||
</protect> | </protect> | ||
Latest revision as of 03:33, 11 March 2016
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS06980 [old locus tag: SAUSA300_1284 ]
- pan locus tag?: SAUPAN003803000
- symbol: SAUSA300_RS06980
- pan gene symbol?: cvfB
- synonym:
- product: virulence factor B
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS06980 [old locus tag: SAUSA300_1284 ]
- symbol: SAUSA300_RS06980
- product: virulence factor B
- replicon: chromosome
- strand: -
- coordinates: 1413294..1414196
- length: 903
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (1413294..1414196) NCBI
- BioCyc: SAUSA300_RS06980 BioCyc
- MicrobesOnline: see SAUSA300_1284
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901ATGGCATTAGACAAAGATATAGTAGGTTCTATAGAATTCCTTGAAGTAGTAGGGTTACAA
GGTTCAACTTACCTTTTAAAAGGACCAAACGGTGAAAACGTAAAGTTAAACCAATCAGAA
ATGAACGATGATGATGAATTAGAAGTAGGTGAAGAATATAGTTTCTTCATTTATCCAAAC
CGTTCAGGTGAATTATTTGCAACTCAAAATATGCCTGATATTACGAAAGATAAATATGAC
TTTGCTAAAGTACTTAAAACGGATCGCGATGGGGCACGTATAGATGTTGGATTACCCCGT
GAAGTGTTAGTACCATGGGAAGATTTACCAAAAGTGAAATCACTATGGCCACAACCTGGT
GATTATTTGCTAGTTACATTACGAATTGACCGTGAGAATCATATGTATGGACGTTTAGCG
AGTGAATCTGTTGTAGAAAATATGTTTACACCTGTACACGACGATAATTTAAAAAACGAA
GTCATTGAAGCCAAACCTTACCGCGTATTACGAATTGGTAGCTTTTTATTAAGCGAATCA
GGTTACAAAATTTTCGTACATGAATCAGAACGTAAAGCTGAACCAAGATTAGGTGAATCT
GTTCAAGTTAGAATTATCGGGCATAATGATAAAGGTGAGTTAAATGGTTCATTTTTACCA
CTTGCACATGAACGTTTAGACGATGACGGCCAAGTCATCTTTGATTTACTAGTTGAATAT
GATGGTGAATTACCATTCTGGGACAAATCAAGCCCTGAAGCGATTAAAGAAGTATTCAAT
ATGAGTAAAGGTTCATTCAAACGTGCAATCGGTCACTTATATAAACAGAAGATTATTAAT
ATAGAAACAGGTAAAATCGCTTTAACTAAAAAAGGTTGGAGTCGAATGGACTCAAAAGAA
TAA60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
903
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS06980 [old locus tag: SAUSA300_1284 ]
- symbol: SAUSA300_RS06980
- description: virulence factor B
- length: 300
- theoretical pI: 4.76461
- theoretical MW: 34198.5
- GRAVY: -0.494667
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAUSA300_1284
- PFAM: OB (CL0021) S1_2; S1 domain (PF13509; HMM-score: 36.5)and 1 moreS1; S1 RNA binding domain (PF00575; HMM-score: 19)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005867
- TAT(Tat/SPI): 0.002812
- LIPO(Sec/SPII): 0.002347
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 447085103 NCBI
- RefSeq: WP_001162359 NCBI
- UniProt: see SAUSA300_1284
⊟Protein sequence[edit | edit source]
- MALDKDIVGSIEFLEVVGLQGSTYLLKGPNGENVKLNQSEMNDDDELEVGEEYSFFIYPNRSGELFATQNMPDITKDKYDFAKVLKTDRDGARIDVGLPREVLVPWEDLPKVKSLWPQPGDYLLVTLRIDRENHMYGRLASESVVENMFTPVHDDNLKNEVIEAKPYRVLRIGSFLLSESGYKIFVHESERKAEPRLGESVQVRIIGHNDKGELNGSFLPLAHERLDDDGQVIFDLLVEYDGELPFWDKSSPEAIKEVFNMSKGSFKRAIGHLYKQKIINIETGKIALTKKGWSRMDSKE
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SAUSA300_RS11505 (deoA) pyrimidine-nucleoside phosphorylase [1] (data from MRSA252) SAUSA300_RS10295 (gatA) glutamyl-tRNA(Gln) amidotransferase subunit A [1] (data from MRSA252) SAUSA300_RS06275 (nusA) transcription termination/antitermination protein NusA [1] (data from MRSA252) SAUSA300_RS00080 50S ribosomal protein L9 [1] (data from MRSA252) SAUSA300_RS01155 formate acetyltransferase [1] (data from MRSA252) SAUSA300_RS01240 nitric oxide dioxygenase [1] (data from MRSA252) SAUSA300_RS01250 L-lactate dehydrogenase [1] (data from MRSA252) SAUSA300_RS01310 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [1] (data from MRSA252) SAUSA300_RS01635 5'-nucleotidase, lipoprotein e(P4) family [1] (data from MRSA252) SAUSA300_RS01885 acetyl-CoA acyltransferase [1] (data from MRSA252) SAUSA300_RS01940 30S ribosomal protein S6 [1] (data from MRSA252) SAUSA300_RS01950 30S ribosomal protein S18 [1] (data from MRSA252) SAUSA300_RS02425 YbaB/EbfC family nucleoid-associated protein [1] (data from MRSA252) SAUSA300_RS02540 pur operon repressor [1] (data from MRSA252) SAUSA300_RS02550 stage V sporulation protein G [1] (data from MRSA252) SAUSA300_RS02565 ribose-phosphate pyrophosphokinase [1] (data from MRSA252) SAUSA300_RS02610 RNA-binding protein S1 [1] (data from MRSA252) SAUSA300_RS02620 hypoxanthine-guanine phosphoribosyltransferase [1] (data from MRSA252) SAUSA300_RS02635 cysteine synthase [1] (data from MRSA252) SAUSA300_RS02800 50S ribosomal protein L1 [1] (data from MRSA252) SAUSA300_RS02805 50S ribosomal protein L10 [1] (data from MRSA252) SAUSA300_RS02810 50S ribosomal protein L7/L12 [1] (data from MRSA252) SAUSA300_RS02825 DNA-directed RNA polymerase subunit beta' [1] (data from MRSA252) SAUSA300_RS02840 30S ribosomal protein S7 [1] (data from MRSA252) SAUSA300_RS02850 elongation factor Tu [1] (data from MRSA252) SAUSA300_RS02860 2-amino-3-ketobutyrate CoA ligase [1] (data from MRSA252) SAUSA300_RS02875 UDP-glucose 4-epimerase [1] (data from MRSA252) SAUSA300_RS02880 branched chain amino acid aminotransferase [1] (data from MRSA252) SAUSA300_RS03205 arginine--tRNA ligase [1] (data from MRSA252) SAUSA300_RS03315 metal ABC transporter substrate-binding protein [1] (data from MRSA252) SAUSA300_RS03410 dihydroxyacetone kinase subunit DhaK [1] (data from MRSA252) SAUSA300_RS03530 LysR family transcriptional regulator [1] (data from MRSA252) SAUSA300_RS03585 hypothetical protein [1] (data from MRSA252) SAUSA300_RS04080 aldehyde dehydrogenase [1] (data from MRSA252) SAUSA300_RS04495 TIGR01457 family HAD-type hydrolase [1] (data from MRSA252) SAUSA300_RS04770 3-oxoacyl-ACP synthase III [1] (data from MRSA252) SAUSA300_RS04855 oligoendopeptidase F [1] (data from MRSA252) SAUSA300_RS04905 enoyl-ACP reductase [1] (data from MRSA252) SAUSA300_RS04925 hypothetical protein [1] (data from MRSA252) SAUSA300_RS05095 1,4-dihydroxy-2-naphthoyl-CoA synthase [1] (data from MRSA252) SAUSA300_RS05295 phosphoenolpyruvate--protein phosphotransferase [1] (data from MRSA252) SAUSA300_RS05325 ribonuclease J 1 [1] (data from MRSA252) SAUSA300_RS05850 cell division protein FtsA [1] (data from MRSA252) SAUSA300_RS05855 cell division protein FtsZ [1] (data from MRSA252) SAUSA300_RS05870 cell division protein SepF [1] (data from MRSA252) SAUSA300_RS05890 isoleucine--tRNA ligase [1] (data from MRSA252) SAUSA300_RS05930 dihydroorotase [1] (data from MRSA252) SAUSA300_RS05940 carbamoyl-phosphate synthase large chain [1] (data from MRSA252) SAUSA300_RS06045 50S ribosomal protein L28 [1] (data from MRSA252) SAUSA300_RS06055 hypothetical protein [1] (data from MRSA252) SAUSA300_RS06075 malonyl CoA-ACP transacylase [1] (data from MRSA252) SAUSA300_RS06090 acyl carrier protein [1] (data from MRSA252) SAUSA300_RS06135 50S ribosomal protein L19 [1] (data from MRSA252) SAUSA300_RS06160 succinyl-CoA ligase subunit beta [1] (data from MRSA252) SAUSA300_RS06220 30S ribosomal protein S2 [1] (data from MRSA252) SAUSA300_RS06230 elongation factor Ts [1] (data from MRSA252) SAUSA300_RS06240 ribosome-recycling factor [1] (data from MRSA252) SAUSA300_RS06260 proline--tRNA ligase [1] (data from MRSA252) SAUSA300_RS06290 translation initiation factor IF-2 [1] (data from MRSA252) SAUSA300_RS06315 polyribonucleotide nucleotidyltransferase [1] (data from MRSA252) SAUSA300_RS06680 catalase [1] (data from MRSA252) SAUSA300_RS06725 transketolase [1] (data from MRSA252) SAUSA300_RS06785 DNA topoisomerase IV subunit B [1] (data from MRSA252) SAUSA300_RS07170 peptide-methionine (R)-S-oxide reductase [1] (data from MRSA252) SAUSA300_RS07405 nucleoside-diphosphate kinase [1] (data from MRSA252) SAUSA300_RS07430 DNA-binding protein HU [1] (data from MRSA252) SAUSA300_RS07465 cytidylate kinase [1] (data from MRSA252) SAUSA300_RS08140 peptidase M24 family protein [1] (data from MRSA252) SAUSA300_RS08165 glycine dehydrogenase [1] (data from MRSA252) SAUSA300_RS08175 aminomethyltransferase [1] (data from MRSA252) SAUSA300_RS08260 superoxide dismutase [1] (data from MRSA252) SAUSA300_RS08285 DEAD/DEAH box family ATP-dependent RNA helicase [1] (data from MRSA252) SAUSA300_RS08370 30S ribosomal protein S21 [1] (data from MRSA252) SAUSA300_RS08470 RNA-binding protein [1] (data from MRSA252) SAUSA300_RS08570 hypothetical protein [1] (data from MRSA252) SAUSA300_RS08720 50S ribosomal protein L27 [1] (data from MRSA252) SAUSA300_RS08730 50S ribosomal protein L21 [1] (data from MRSA252) SAUSA300_RS08865 50S ribosomal protein L20 [1] (data from MRSA252) SAUSA300_RS08870 50S ribosomal protein L35 [1] (data from MRSA252) SAUSA300_RS08875 translation initiation factor IF-3 [1] (data from MRSA252) SAUSA300_RS08885 threonine--tRNA ligase [1] (data from MRSA252) SAUSA300_RS08975 pyruvate kinase [1] (data from MRSA252) SAUSA300_RS08980 ATP-dependent 6-phosphofructokinase [1] (data from MRSA252) SAUSA300_RS09015 universal stress protein [1] (data from MRSA252) SAUSA300_RS09040 universal stress protein UspA [1] (data from MRSA252) SAUSA300_RS09090 30S ribosomal protein S4 [1] (data from MRSA252) SAUSA300_RS09140 serine protease [1] (data from MRSA252) SAUSA300_RS09165 formate--tetrahydrofolate ligase [1] (data from MRSA252) SAUSA300_RS09185 catabolite control protein A [1] (data from MRSA252) SAUSA300_RS09195 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase [1] (data from MRSA252) SAUSA300_RS09205 membrane protein [1] (data from MRSA252) SAUSA300_RS09225 tRNA-binding protein [1] (data from MRSA252) SAUSA300_RS09235 thiol reductase thioredoxin [1] (data from MRSA252) SAUSA300_RS09270 dipeptidase PepV [1] (data from MRSA252) SAUSA300_RS09305 leucine--tRNA ligase [1] (data from MRSA252) SAUSA300_RS09425 transaldolase [1] (data from MRSA252) SAUSA300_RS09470 phosphoenolpyruvate carboxykinase (ATP) [1] (data from MRSA252) SAUSA300_RS10290 aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [1] (data from MRSA252) SAUSA300_RS10450 thioredoxin family protein [1] (data from MRSA252) SAUSA300_RS10905 co-chaperone GroES [1] (data from MRSA252) SAUSA300_RS11130 anti-sigma B factor antagonist [1] (data from MRSA252) SAUSA300_RS11220 D-alanine--D-alanine ligase [1] (data from MRSA252) SAUSA300_RS11310 beta-hydroxyacyl-ACP dehydratase [1] (data from MRSA252) SAUSA300_RS11335 ATP synthase subunit beta [1] (data from MRSA252) SAUSA300_RS11380 uracil phosphoribosyltransferase [1] (data from MRSA252) SAUSA300_RS11420 50S ribosomal protein L31 type B [1] (data from MRSA252) SAUSA300_RS11440 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [1] (data from MRSA252) SAUSA300_RS11600 glutamine--fructose-6-phosphate aminotransferase [1] (data from MRSA252) SAUSA300_RS11620 mannitol-1-phosphate 5-dehydrogenase [1] (data from MRSA252) SAUSA300_RS11985 30S ribosomal protein S9 [1] (data from MRSA252) SAUSA300_RS11990 50S ribosomal protein L13 [1] (data from MRSA252) SAUSA300_RS12020 DNA-directed RNA polymerase subunit alpha [1] (data from MRSA252) SAUSA300_RS12025 30S ribosomal protein S11 [1] (data from MRSA252) SAUSA300_RS12030 30S ribosomal protein S13 [1] (data from MRSA252) SAUSA300_RS12045 adenylate kinase [1] (data from MRSA252) SAUSA300_RS12055 50S ribosomal protein L15 [1] (data from MRSA252) SAUSA300_RS12065 30S ribosomal protein S5 [1] (data from MRSA252) SAUSA300_RS12070 50S ribosomal protein L18 [1] (data from MRSA252) SAUSA300_RS12075 50S ribosomal protein L6 [1] (data from MRSA252) SAUSA300_RS12090 50S ribosomal protein L5 [1] (data from MRSA252) SAUSA300_RS12095 50S ribosomal protein L24 [1] (data from MRSA252) SAUSA300_RS12105 30S ribosomal protein S17 [1] (data from MRSA252) SAUSA300_RS12110 50S ribosomal protein L29 [1] (data from MRSA252) SAUSA300_RS12120 30S ribosomal protein S3 [1] (data from MRSA252) SAUSA300_RS12125 50S ribosomal protein L22 [1] (data from MRSA252) SAUSA300_RS12130 30S ribosomal protein S19 [1] (data from MRSA252) SAUSA300_RS12135 50S ribosomal protein L2 [1] (data from MRSA252) SAUSA300_RS12140 50S ribosomal protein L23 [1] (data from MRSA252) SAUSA300_RS12145 50S ribosomal protein L4 [1] (data from MRSA252) SAUSA300_RS12150 50S ribosomal protein L3 [1] (data from MRSA252) SAUSA300_RS12450 2-hydroxyacid dehydrogenase [1] (data from MRSA252) SAUSA300_RS13840 L-glutamate gamma-semialdehyde dehydrogenase [1] (data from MRSA252) SAUSA300_RS13915 transglycosylase IsaA [1] (data from MRSA252) SAUSA300_RS14060 3-methyl-2-oxobutanoate hydroxymethyltransferase [1] (data from MRSA252) SAUSA300_RS14295 arginine deiminase [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.000 1.001 1.002 1.003 1.004 1.005 1.006 1.007 1.008 1.009 1.010 1.011 1.012 1.013 1.014 1.015 1.016 1.017 1.018 1.019 1.020 1.021 1.022 1.023 1.024 1.025 1.026 1.027 1.028 1.029 1.030 1.031 1.032 1.033 1.034 1.035 1.036 1.037 1.038 1.039 1.040 1.041 1.042 1.043 1.044 1.045 1.046 1.047 1.048 1.049 1.050 1.051 1.052 1.053 1.054 1.055 1.056 1.057 1.058 1.059 1.060 1.061 1.062 1.063 1.064 1.065 1.066 1.067 1.068 1.069 1.070 1.071 1.072 1.073 1.074 1.075 1.076 1.077 1.078 1.079 1.080 1.081 1.082 1.083 1.084 1.085 1.086 1.087 1.088 1.089 1.090 1.091 1.092 1.093 1.094 1.095 1.096 1.097 1.098 1.099 1.100 1.101 1.102 1.103 1.104 1.105 1.106 1.107 1.108 1.109 1.110 1.111 1.112 1.113 1.114 1.115 1.116 1.117 1.118 1.119 1.120 1.121 1.122 1.123 1.124 1.125 1.126 1.127 1.128 1.129 1.130 1.131 1.132 1.133 1.134 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)