Jump to navigation
Jump to search
m (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "") |
m (Text replacement - "gene Genbank" to "gene RefSeq") |
||
Line 1: | Line 1: | ||
__TOC__ | |||
<protect> | <protect> | ||
<aureodatabase> | <aureodatabase>annotation</aureodatabase> | ||
=Summary= | =Summary= | ||
* <aureodatabase>organism</aureodatabase> | *<aureodatabase>organism</aureodatabase> | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>pan locus</aureodatabase> | *<aureodatabase>pan locus</aureodatabase> | ||
* <aureodatabase>gene symbol</aureodatabase> | *<aureodatabase>gene symbol</aureodatabase> | ||
* <aureodatabase>pan gene symbol</aureodatabase> | *<aureodatabase>pan gene symbol</aureodatabase> | ||
* <aureodatabase>gene synonyms</aureodatabase> | *<aureodatabase>gene synonyms</aureodatabase> | ||
* <aureodatabase>product</aureodatabase> | *<aureodatabase>product</aureodatabase> | ||
</protect> | </protect> | ||
Line 24: | Line 25: | ||
==General== | ==General== | ||
* <aureodatabase>gene type</aureodatabase> | *<aureodatabase>gene type</aureodatabase> | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>gene symbol</aureodatabase> | *<aureodatabase>gene symbol</aureodatabase> | ||
* <aureodatabase>product</aureodatabase> | *<aureodatabase>product</aureodatabase> | ||
* <aureodatabase>gene replicon</aureodatabase> | *<aureodatabase>gene replicon</aureodatabase> | ||
* <aureodatabase>strand</aureodatabase> | *<aureodatabase>strand</aureodatabase> | ||
* <aureodatabase>gene coordinates</aureodatabase> | *<aureodatabase>gene coordinates</aureodatabase> | ||
* <aureodatabase>gene length</aureodatabase> | *<aureodatabase>gene length</aureodatabase> | ||
* <aureodatabase>essential</aureodatabase> | *<aureodatabase>essential</aureodatabase> | ||
*<aureodatabase>gene comment</aureodatabase> | |||
</protect> | </protect> | ||
Line 38: | Line 40: | ||
==Accession numbers== | ==Accession numbers== | ||
* <aureodatabase>gene | *<aureodatabase>gene location</aureodatabase> | ||
* <aureodatabase>gene | *<aureodatabase>gene BioCyc</aureodatabase> | ||
*<aureodatabase>gene MicrobesOnline</aureodatabase> | |||
</protect> | </protect> | ||
<protect> | <protect> | ||
==Phenotype== | ==Phenotype== | ||
</protect> | </protect> | ||
Share your knowledge and add information here. [<span class="plainlinks">[//aureowiki.med.uni-greifswald.de/index.php?title={{PAGENAMEE}}&veaction=edit§ion=6 edit]</span>] | |||
<protect> | <protect> | ||
==DNA sequence== | ==DNA sequence== | ||
* <aureodatabase>gene sequence</aureodatabase> | *<aureodatabase>gene sequence</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
<aureodatabase>RNA regulated operons</aureodatabase> | |||
</protect> | |||
<protect> | |||
=Protein= | =Protein= | ||
<aureodatabase>protein 3D view</aureodatabase> | <aureodatabase>protein 3D view</aureodatabase> | ||
==General== | ==General== | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>protein symbol</aureodatabase> | *<aureodatabase>protein symbol</aureodatabase> | ||
* <aureodatabase>protein description</aureodatabase> | *<aureodatabase>protein description</aureodatabase> | ||
* <aureodatabase>protein length</aureodatabase> | *<aureodatabase>protein length</aureodatabase> | ||
* <aureodatabase>theoretical pI</aureodatabase> | *<aureodatabase>theoretical pI</aureodatabase> | ||
* <aureodatabase>theoretical MW</aureodatabase> | *<aureodatabase>theoretical MW</aureodatabase> | ||
* <aureodatabase>GRAVY</aureodatabase> | *<aureodatabase>GRAVY</aureodatabase> | ||
</protect> | </protect> | ||
Line 71: | Line 77: | ||
==Function== | ==Function== | ||
* <aureodatabase>protein reaction</aureodatabase> | *<aureodatabase>protein reaction</aureodatabase> | ||
* <aureodatabase>protein TIGRFAM</aureodatabase> | *<aureodatabase>protein TIGRFAM</aureodatabase> | ||
* <aureodatabase>protein TheSeed</aureodatabase> | *<aureodatabase>protein TheSeed</aureodatabase> | ||
* <aureodatabase>protein PFAM</aureodatabase> | *<aureodatabase>protein PFAM</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
==Structure, modifications & | ==Structure, modifications & cofactors== | ||
* <aureodatabase>protein domains</aureodatabase> | *<aureodatabase>protein domains</aureodatabase> | ||
* <aureodatabase>protein modifications</aureodatabase> | *<aureodatabase>protein modifications</aureodatabase> | ||
* <aureodatabase>protein cofactors</aureodatabase> | *<aureodatabase>protein cofactors</aureodatabase> | ||
* <aureodatabase>protein effectors</aureodatabase> | *<aureodatabase>protein effectors</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein regulated operons</aureodatabase> | ||
</protect> | </protect> | ||
Line 90: | Line 96: | ||
==Localization== | ==Localization== | ||
* <aureodatabase>protein Psortb</aureodatabase> | *<aureodatabase>protein Psortb</aureodatabase> | ||
* <aureodatabase>protein LocateP</aureodatabase> | *<aureodatabase>protein LocateP</aureodatabase> | ||
* <aureodatabase>protein SignalP</aureodatabase> | *<aureodatabase>protein SignalP</aureodatabase> | ||
* <aureodatabase>protein TMHMM</aureodatabase> | *<aureodatabase>protein TMHMM</aureodatabase> | ||
</protect> | </protect> | ||
Line 99: | Line 105: | ||
==Accession numbers== | ==Accession numbers== | ||
* <aureodatabase>protein GI</aureodatabase> | *<aureodatabase>protein GI</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein RefSeq</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein UniProt</aureodatabase> | ||
</protect> | </protect> | ||
Line 107: | Line 113: | ||
==Protein sequence== | ==Protein sequence== | ||
* <aureodatabase>protein sequence</aureodatabase> | *<aureodatabase>protein sequence</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
== | ==Experimental data== | ||
* <aureodatabase>protein validated peptides</aureodatabase> | *<aureodatabase>protein validated peptides</aureodatabase> | ||
*<aureodatabase>protein validated localization</aureodatabase> | |||
*<aureodatabase>protein validated quantitative data</aureodatabase> | |||
*<aureodatabase>protein partners</aureodatabase> | |||
</protect> | </protect> | ||
Line 124: | Line 133: | ||
==Operon== | ==Operon== | ||
* <aureodatabase>operons</aureodatabase> | *<aureodatabase>operons</aureodatabase> | ||
</protect> | </protect> | ||
Line 130: | Line 139: | ||
==Regulation== | ==Regulation== | ||
*<aureodatabase>regulators</aureodatabase> | |||
* <aureodatabase>regulators</aureodatabase> | |||
</protect> | </protect> | ||
Line 137: | Line 145: | ||
==Transcription pattern== | ==Transcription pattern== | ||
* <aureodatabase>expression browser</aureodatabase> | *<aureodatabase>expression browser</aureodatabase> | ||
</protect> | </protect> | ||
Line 143: | Line 151: | ||
==Protein synthesis (provided by Aureolib)== | ==Protein synthesis (provided by Aureolib)== | ||
* <aureodatabase>protein synthesis Aureolib</aureodatabase> | *<aureodatabase>protein synthesis Aureolib</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
== | ==Protein stability== | ||
* <aureodatabase>protein half-life</aureodatabase> | *<aureodatabase>protein half-life</aureodatabase> | ||
</protect> | </protect> | ||
Latest revision as of 12:59, 11 March 2016
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS04195 [old locus tag: SAUSA300_0778 ]
- pan locus tag?: SAUPAN002803000
- symbol: SAUSA300_RS04195
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS04195 [old locus tag: SAUSA300_0778 ]
- symbol: SAUSA300_RS04195
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 867954..868172
- length: 219
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (867954..868172) NCBI
- BioCyc: see SAUSA300_0778
- MicrobesOnline: see SAUSA300_0778
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAGTGAATGGCATATTAATAATCAATCTACAAAACCTTTTTTAATACAACAAGCGGAA
AAGCAATTGTCTATTGTTAAACCGTTGCCTAATGGTAGCTTCCAAATACTCACAGAAATA
AATTTGGAGAATGGCAATATTAGTAACATCGATCATTCTTTACTTGTTTCAGTAGACCCC
AAAGCATTAGAAATAAGTATATTTGACGCTGTAAATTAA60
120
180
219
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS04195 [old locus tag: SAUSA300_0778 ]
- symbol: SAUSA300_RS04195
- description: hypothetical protein
- length: 72
- theoretical pI: 4.53222
- theoretical MW: 8043.08
- GRAVY: -0.111111
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAUSA300_0778
- PFAM:
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00264
- TAT(Tat/SPI): 0.000126
- LIPO(Sec/SPII): 0.000263
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 445928031 NCBI
- RefSeq: WP_000005886 NCBI
- UniProt: see SAUSA300_0778
⊟Protein sequence[edit | edit source]
- MSEWHINNQSTKPFLIQQAEKQLSIVKPLPNGSFQILTEINLENGNISNIDHSLLVSVDPKALEISIFDAVN
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
SAUSA300_RS07335 (asnC) asparagine--tRNA ligase [1] (data from MRSA252) SAUSA300_RS11505 (deoA) pyrimidine-nucleoside phosphorylase [1] (data from MRSA252) SAUSA300_RS06275 (nusA) transcription termination/antitermination protein NusA [1] (data from MRSA252) SAUSA300_RS00050 serine--tRNA ligase [1] (data from MRSA252) SAUSA300_RS00080 50S ribosomal protein L9 [1] (data from MRSA252) SAUSA300_RS00585 peptidoglycan-binding protein LysM [1] (data from MRSA252) SAUSA300_RS00735 2-deoxyribose-5-phosphate aldolase [1] (data from MRSA252) SAUSA300_RS01155 formate acetyltransferase [1] (data from MRSA252) SAUSA300_RS01250 L-lactate dehydrogenase [1] (data from MRSA252) SAUSA300_RS01885 acetyl-CoA acyltransferase [1] (data from MRSA252) SAUSA300_RS02025 alkyl hydroperoxide reductase subunit C [1] (data from MRSA252) SAUSA300_RS02055 hypothetical protein [1] (data from MRSA252) SAUSA300_RS02070 IMP dehydrogenase [1] (data from MRSA252) SAUSA300_RS02425 YbaB/EbfC family nucleoid-associated protein [1] (data from MRSA252) SAUSA300_RS02635 cysteine synthase [1] (data from MRSA252) SAUSA300_RS02700 pyridoxal 5'-phosphate synthase lyase subunit PdxS [1] (data from MRSA252) SAUSA300_RS02800 50S ribosomal protein L1 [1] (data from MRSA252) SAUSA300_RS02805 50S ribosomal protein L10 [1] (data from MRSA252) SAUSA300_RS02810 50S ribosomal protein L7/L12 [1] (data from MRSA252) SAUSA300_RS02820 DNA-directed RNA polymerase subunit beta [1] (data from MRSA252) SAUSA300_RS02825 DNA-directed RNA polymerase subunit beta' [1] (data from MRSA252) SAUSA300_RS02845 elongation factor G [1] (data from MRSA252) SAUSA300_RS02850 elongation factor Tu [1] (data from MRSA252) SAUSA300_RS03045 heme-binding protein [1] (data from MRSA252) SAUSA300_RS03190 zinc-dependent alcohol dehydrogenase [1] (data from MRSA252) SAUSA300_RS03205 arginine--tRNA ligase [1] (data from MRSA252) SAUSA300_RS03410 dihydroxyacetone kinase subunit DhaK [1] (data from MRSA252) SAUSA300_RS03480 hypothetical protein [1] (data from MRSA252) SAUSA300_RS03960 ribosomal subunit interface protein [1] (data from MRSA252) SAUSA300_RS04030 thioredoxin reductase [1] (data from MRSA252) SAUSA300_RS04080 aldehyde dehydrogenase [1] (data from MRSA252) SAUSA300_RS04085 phosphoglycerate kinase [1] (data from MRSA252) SAUSA300_RS04095 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [1] (data from MRSA252) SAUSA300_RS04100 enolase [1] (data from MRSA252) SAUSA300_RS04265 arsenate reductase [1] (data from MRSA252) SAUSA300_RS04270 glycine cleavage system protein H [1] (data from MRSA252) SAUSA300_RS04410 ABC transporter ATP-binding protein [1] (data from MRSA252) SAUSA300_RS04525 D-alanine--poly(phosphoribitol) ligase subunit 2 [1] (data from MRSA252) SAUSA300_RS04560 NADH dehydrogenase [1] (data from MRSA252) SAUSA300_RS04670 glucose-6-phosphate isomerase [1] (data from MRSA252) SAUSA300_RS04700 hypothetical protein [1] (data from MRSA252) SAUSA300_RS04775 beta-ketoacyl-[acyl-carrier-protein] synthase II [1] (data from MRSA252) SAUSA300_RS05095 1,4-dihydroxy-2-naphthoyl-CoA synthase [1] (data from MRSA252) SAUSA300_RS05290 phosphocarrier protein HPr [1] (data from MRSA252) SAUSA300_RS05325 ribonuclease J 1 [1] (data from MRSA252) SAUSA300_RS05350 pyruvate dehydrogenase E1 component subunit alpha [1] (data from MRSA252) SAUSA300_RS05355 pyruvate dehydrogenase E1 component subunit beta [1] (data from MRSA252) SAUSA300_RS05360 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex [1] (data from MRSA252) SAUSA300_RS05365 dihydrolipoyl dehydrogenase [1] (data from MRSA252) SAUSA300_RS05855 cell division protein FtsZ [1] (data from MRSA252) SAUSA300_RS05885 cell division protein DivIVA [1] (data from MRSA252) SAUSA300_RS06080 beta-ketoacyl-ACP reductase [1] (data from MRSA252) SAUSA300_RS06160 succinyl-CoA ligase subunit beta [1] (data from MRSA252) SAUSA300_RS06165 succinyl-CoA ligase subunit alpha [1] (data from MRSA252) SAUSA300_RS06210 GTP-sensing pleiotropic transcriptional regulator CodY [1] (data from MRSA252) SAUSA300_RS06230 elongation factor Ts [1] (data from MRSA252) SAUSA300_RS06485 glutamine synthetase [1] (data from MRSA252) SAUSA300_RS06725 transketolase [1] (data from MRSA252) SAUSA300_RS06765 aconitate hydratase [1] (data from MRSA252) SAUSA300_RS06985 ABC transporter ATP-binding protein [1] (data from MRSA252) SAUSA300_RS07035 cold-shock protein CspA [1] (data from MRSA252) SAUSA300_RS07100 dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex [1] (data from MRSA252) SAUSA300_RS07105 2-oxoglutarate dehydrogenase E1 component [1] (data from MRSA252) SAUSA300_RS07430 DNA-binding protein HU [1] (data from MRSA252) SAUSA300_RS07970 phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating) [1] (data from MRSA252) SAUSA300_RS08135 elongation factor P [1] (data from MRSA252) SAUSA300_RS08170 glycine dehydrogenase [1] (data from MRSA252) SAUSA300_RS08260 superoxide dismutase [1] (data from MRSA252) SAUSA300_RS08320 glycine--tRNA ligase [1] (data from MRSA252) SAUSA300_RS08395 molecular chaperone DnaK [1] (data from MRSA252) SAUSA300_RS08730 50S ribosomal protein L21 [1] (data from MRSA252) SAUSA300_RS08840 trigger factor [1] (data from MRSA252) SAUSA300_RS08875 translation initiation factor IF-3 [1] (data from MRSA252) SAUSA300_RS08885 threonine--tRNA ligase [1] (data from MRSA252) SAUSA300_RS08910 aldehyde dehydrogenase [1] (data from MRSA252) SAUSA300_RS08915 dephospho-CoA kinase [1] (data from MRSA252) SAUSA300_RS08955 citrate synthase [1] (data from MRSA252) SAUSA300_RS08975 pyruvate kinase [1] (data from MRSA252) SAUSA300_RS09015 universal stress protein [1] (data from MRSA252) SAUSA300_RS09035 alanine dehydrogenase [1] (data from MRSA252) SAUSA300_RS09040 universal stress protein UspA [1] (data from MRSA252) SAUSA300_RS09045 acetate kinase [1] (data from MRSA252) SAUSA300_RS09055 2-Cys peroxiredoxin [1] (data from MRSA252) SAUSA300_RS09090 30S ribosomal protein S4 [1] (data from MRSA252) SAUSA300_RS09165 formate--tetrahydrofolate ligase [1] (data from MRSA252) SAUSA300_RS09185 catabolite control protein A [1] (data from MRSA252) SAUSA300_RS09425 transaldolase [1] (data from MRSA252) SAUSA300_RS10290 aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [1] (data from MRSA252) SAUSA300_RS10900 molecular chaperone GroEL [1] (data from MRSA252) SAUSA300_RS11220 D-alanine--D-alanine ligase [1] (data from MRSA252) SAUSA300_RS11430 aldehyde dehydrogenase family protein [1] (data from MRSA252) SAUSA300_RS11440 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [1] (data from MRSA252) SAUSA300_RS11445 fructose-bisphosphate aldolase [1] (data from MRSA252) SAUSA300_RS11460 DNA-directed RNA polymerase subunit delta [1] (data from MRSA252) SAUSA300_RS11520 purine-nucleoside phosphorylase [1] (data from MRSA252) SAUSA300_RS11600 glutamine--fructose-6-phosphate aminotransferase [1] (data from MRSA252) SAUSA300_RS11620 mannitol-1-phosphate 5-dehydrogenase [1] (data from MRSA252) SAUSA300_RS11805 Asp23/Gls24 family envelope stress response protein [1] (data from MRSA252) SAUSA300_RS11985 30S ribosomal protein S9 [1] (data from MRSA252) SAUSA300_RS11990 50S ribosomal protein L13 [1] (data from MRSA252) SAUSA300_RS12015 50S ribosomal protein L17 [1] (data from MRSA252) SAUSA300_RS12025 30S ribosomal protein S11 [1] (data from MRSA252) SAUSA300_RS12055 50S ribosomal protein L15 [1] (data from MRSA252) SAUSA300_RS12065 30S ribosomal protein S5 [1] (data from MRSA252) SAUSA300_RS12075 50S ribosomal protein L6 [1] (data from MRSA252) SAUSA300_RS12090 50S ribosomal protein L5 [1] (data from MRSA252) SAUSA300_RS12105 30S ribosomal protein S17 [1] (data from MRSA252) SAUSA300_RS12115 50S ribosomal protein L16 [1] (data from MRSA252) SAUSA300_RS12120 30S ribosomal protein S3 [1] (data from MRSA252) SAUSA300_RS12125 50S ribosomal protein L22 [1] (data from MRSA252) SAUSA300_RS12130 30S ribosomal protein S19 [1] (data from MRSA252) SAUSA300_RS12135 50S ribosomal protein L2 [1] (data from MRSA252) SAUSA300_RS12140 50S ribosomal protein L23 [1] (data from MRSA252) SAUSA300_RS12150 50S ribosomal protein L3 [1] (data from MRSA252) SAUSA300_RS12450 2-hydroxyacid dehydrogenase [1] (data from MRSA252) SAUSA300_RS12800 quinone oxidoreductase [1] (data from MRSA252) SAUSA300_RS13795 hydroxymethylglutaryl-CoA synthase [1] (data from MRSA252) SAUSA300_RS14100 class I fructose-bisphosphate aldolase [1] (data from MRSA252) SAUSA300_RS14105 malate:quinone oxidoreductase [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.000 1.001 1.002 1.003 1.004 1.005 1.006 1.007 1.008 1.009 1.010 1.011 1.012 1.013 1.014 1.015 1.016 1.017 1.018 1.019 1.020 1.021 1.022 1.023 1.024 1.025 1.026 1.027 1.028 1.029 1.030 1.031 1.032 1.033 1.034 1.035 1.036 1.037 1.038 1.039 1.040 1.041 1.042 1.043 1.044 1.045 1.046 1.047 1.048 1.049 1.050 1.051 1.052 1.053 1.054 1.055 1.056 1.057 1.058 1.059 1.060 1.061 1.062 1.063 1.064 1.065 1.066 1.067 1.068 1.069 1.070 1.071 1.072 1.073 1.074 1.075 1.076 1.077 1.078 1.079 1.080 1.081 1.082 1.083 1.084 1.085 1.086 1.087 1.088 1.089 1.090 1.091 1.092 1.093 1.094 1.095 1.096 1.097 1.098 1.099 1.100 1.101 1.102 1.103 1.104 1.105 1.106 1.107 1.108 1.109 1.110 1.111 1.112 1.113 1.114 1.115 1.116 1.117 1.118 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)