Jump to navigation
Jump to search
m (Text replacement - "gene Genbank" to "gene RefSeq") |
m (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "") |
||
Line 1: | Line 1: | ||
__TOC__ | |||
<protect> | <protect> | ||
<aureodatabase> | <aureodatabase>annotation</aureodatabase> | ||
=Summary= | =Summary= | ||
* <aureodatabase>organism</aureodatabase> | *<aureodatabase>organism</aureodatabase> | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>pan locus</aureodatabase> | *<aureodatabase>pan locus</aureodatabase> | ||
* <aureodatabase>gene symbol</aureodatabase> | *<aureodatabase>gene symbol</aureodatabase> | ||
* <aureodatabase>pan gene symbol</aureodatabase> | *<aureodatabase>pan gene symbol</aureodatabase> | ||
* <aureodatabase>gene synonyms</aureodatabase> | *<aureodatabase>gene synonyms</aureodatabase> | ||
* <aureodatabase>product</aureodatabase> | *<aureodatabase>product</aureodatabase> | ||
</protect> | </protect> | ||
Line 24: | Line 25: | ||
==General== | ==General== | ||
* <aureodatabase>gene type</aureodatabase> | *<aureodatabase>gene type</aureodatabase> | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>gene symbol</aureodatabase> | *<aureodatabase>gene symbol</aureodatabase> | ||
* <aureodatabase>product</aureodatabase> | *<aureodatabase>product</aureodatabase> | ||
* <aureodatabase>gene replicon</aureodatabase> | *<aureodatabase>gene replicon</aureodatabase> | ||
* <aureodatabase>strand</aureodatabase> | *<aureodatabase>strand</aureodatabase> | ||
* <aureodatabase>gene coordinates</aureodatabase> | *<aureodatabase>gene coordinates</aureodatabase> | ||
* <aureodatabase>gene length</aureodatabase> | *<aureodatabase>gene length</aureodatabase> | ||
* <aureodatabase>essential</aureodatabase> | *<aureodatabase>essential</aureodatabase> | ||
*<aureodatabase>gene comment</aureodatabase> | |||
</protect> | </protect> | ||
Line 38: | Line 40: | ||
==Accession numbers== | ==Accession numbers== | ||
* <aureodatabase>gene | *<aureodatabase>gene location</aureodatabase> | ||
* <aureodatabase>gene | *<aureodatabase>gene BioCyc</aureodatabase> | ||
*<aureodatabase>gene MicrobesOnline</aureodatabase> | |||
</protect> | </protect> | ||
<protect> | <protect> | ||
==Phenotype== | ==Phenotype== | ||
</protect> | </protect> | ||
Share your knowledge and add information here. [<span class="plainlinks">[//aureowiki.med.uni-greifswald.de/index.php?title={{PAGENAMEE}}&veaction=edit§ion=6 edit]</span>] | |||
<protect> | <protect> | ||
==DNA sequence== | ==DNA sequence== | ||
* <aureodatabase>gene sequence</aureodatabase> | *<aureodatabase>gene sequence</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
<aureodatabase>RNA regulated operons</aureodatabase> | |||
</protect> | |||
<protect> | |||
=Protein= | =Protein= | ||
<aureodatabase>protein 3D view</aureodatabase> | <aureodatabase>protein 3D view</aureodatabase> | ||
==General== | ==General== | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>protein symbol</aureodatabase> | *<aureodatabase>protein symbol</aureodatabase> | ||
* <aureodatabase>protein description</aureodatabase> | *<aureodatabase>protein description</aureodatabase> | ||
* <aureodatabase>protein length</aureodatabase> | *<aureodatabase>protein length</aureodatabase> | ||
* <aureodatabase>theoretical pI</aureodatabase> | *<aureodatabase>theoretical pI</aureodatabase> | ||
* <aureodatabase>theoretical MW</aureodatabase> | *<aureodatabase>theoretical MW</aureodatabase> | ||
* <aureodatabase>GRAVY</aureodatabase> | *<aureodatabase>GRAVY</aureodatabase> | ||
</protect> | </protect> | ||
Line 71: | Line 77: | ||
==Function== | ==Function== | ||
* <aureodatabase>protein reaction</aureodatabase> | *<aureodatabase>protein reaction</aureodatabase> | ||
* <aureodatabase>protein TIGRFAM</aureodatabase> | *<aureodatabase>protein TIGRFAM</aureodatabase> | ||
* <aureodatabase>protein TheSeed</aureodatabase> | *<aureodatabase>protein TheSeed</aureodatabase> | ||
* <aureodatabase>protein PFAM</aureodatabase> | *<aureodatabase>protein PFAM</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
==Structure, modifications & | ==Structure, modifications & cofactors== | ||
* <aureodatabase>protein domains</aureodatabase> | *<aureodatabase>protein domains</aureodatabase> | ||
* <aureodatabase>protein modifications</aureodatabase> | *<aureodatabase>protein modifications</aureodatabase> | ||
* <aureodatabase>protein cofactors</aureodatabase> | *<aureodatabase>protein cofactors</aureodatabase> | ||
* <aureodatabase>protein effectors</aureodatabase> | *<aureodatabase>protein effectors</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein regulated operons</aureodatabase> | ||
</protect> | </protect> | ||
Line 90: | Line 96: | ||
==Localization== | ==Localization== | ||
* <aureodatabase>protein Psortb</aureodatabase> | *<aureodatabase>protein Psortb</aureodatabase> | ||
* <aureodatabase>protein LocateP</aureodatabase> | *<aureodatabase>protein LocateP</aureodatabase> | ||
* <aureodatabase>protein SignalP</aureodatabase> | *<aureodatabase>protein SignalP</aureodatabase> | ||
* <aureodatabase>protein TMHMM</aureodatabase> | *<aureodatabase>protein TMHMM</aureodatabase> | ||
</protect> | </protect> | ||
Line 99: | Line 105: | ||
==Accession numbers== | ==Accession numbers== | ||
* <aureodatabase>protein GI</aureodatabase> | *<aureodatabase>protein GI</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein RefSeq</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein UniProt</aureodatabase> | ||
</protect> | </protect> | ||
Line 108: | Line 113: | ||
==Protein sequence== | ==Protein sequence== | ||
* <aureodatabase>protein sequence</aureodatabase> | *<aureodatabase>protein sequence</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
== | ==Experimental data== | ||
* <aureodatabase>protein validated peptides</aureodatabase> | *<aureodatabase>protein validated peptides</aureodatabase> | ||
*<aureodatabase>protein validated localization</aureodatabase> | |||
*<aureodatabase>protein validated quantitative data</aureodatabase> | |||
*<aureodatabase>protein partners</aureodatabase> | |||
</protect> | </protect> | ||
Line 125: | Line 133: | ||
==Operon== | ==Operon== | ||
* <aureodatabase>operons</aureodatabase> | *<aureodatabase>operons</aureodatabase> | ||
</protect> | </protect> | ||
Line 131: | Line 139: | ||
==Regulation== | ==Regulation== | ||
*<aureodatabase>regulators</aureodatabase> | |||
* <aureodatabase>regulators</aureodatabase> | |||
</protect> | </protect> | ||
Line 138: | Line 145: | ||
==Transcription pattern== | ==Transcription pattern== | ||
* <aureodatabase>expression browser</aureodatabase> | *<aureodatabase>expression browser</aureodatabase> | ||
</protect> | </protect> | ||
Line 144: | Line 151: | ||
==Protein synthesis (provided by Aureolib)== | ==Protein synthesis (provided by Aureolib)== | ||
* <aureodatabase>protein synthesis Aureolib</aureodatabase> | *<aureodatabase>protein synthesis Aureolib</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
== | ==Protein stability== | ||
* <aureodatabase>protein half-life</aureodatabase> | *<aureodatabase>protein half-life</aureodatabase> | ||
</protect> | </protect> | ||
Latest revision as of 10:46, 11 March 2016
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS02800 [old locus tag: SAUSA300_0523 ]
- pan locus tag?: SAUPAN002308000
- symbol: SAUSA300_RS02800
- pan gene symbol?: rplA
- synonym:
- product: 50S ribosomal protein L1
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS02800 [old locus tag: SAUSA300_0523 ]
- symbol: SAUSA300_RS02800
- product: 50S ribosomal protein L1
- replicon: chromosome
- strand: +
- coordinates: 582681..583373
- length: 693
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (582681..583373) NCBI
- BioCyc: SAUSA300_RS02800 BioCyc
- MicrobesOnline: see SAUSA300_0523
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661ATGGCTAAAAAAGGTAAAAAGTATCAAGAAGCAGCTAGTAAAGTTGACCGTACTCAGCAC
TACAGTGTTGAAGAAGCAATTAAATTAGCTAAAGAAACAAGCATTGCTAACTTTGACGCT
TCTGTTGAAGTTGCATTCCGTTTAGGAATTGATACACGTAAAAATGACCAACAAATCCGT
GGTGCAGTTGTATTACCAAACGGAACTGGTAAATCACAAAGTGTATTAGTATTCGCTAAA
GGTGACAAAATTGCTGAAGCTGAAGCAGCAGGTGCTGACTATGTAGGTGAAGCAGAATAC
GTTCAAAAAATCCAACAAGGTTGGTTCGACTTCGATGTAGTAGTTGCTACACCAGACATG
ATGGGTGAAGTTGGTAAATTAGGTCGTGTATTAGGACCAAAAGGTTTAATGCCAAACCCT
AAAACTGGAACTGTAACAATGGATGTTAAAAAAGCTGTTGAAGAAATCAAAGCTGGTAAA
GTAGAATATCGTGCTGAAAAAGCTGGTATCGTACATGCATCAATTGGTAAAGTTTCATTT
ACTGATGAACAATTAATTGAAAACTTCAATACTTTACAAGATGTATTAGCTAAAGCTAAA
CCATCATCTGCTAAAGGTACATACTTCAAATCTGTTGCTGTAACTACAACAATGGGTCCT
GGAGTTAAAATTGATACTGCAAGTTTCAAATAA60
120
180
240
300
360
420
480
540
600
660
693
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS02800 [old locus tag: SAUSA300_0523 ]
- symbol: SAUSA300_RS02800
- description: 50S ribosomal protein L1
- length: 230
- theoretical pI: 9.60658
- theoretical MW: 24708.1
- GRAVY: -0.29087
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL1 (TIGR01169; HMM-score: 352.6)and 1 moreProtein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL1, mitochondrial (TIGR01170; HMM-score: 97.6)
- TheSEED: see SAUSA300_0523
- PFAM: no clan defined Ribosomal_L1; Ribosomal protein L1p/L10e family (PF00687; HMM-score: 185.5)and 2 moreDUF3599; Domain of unknown function (DUF3599) (PF12206; HMM-score: 13)Patatin (CL0323) SAT; Starter unit:ACP transacylase in aflatoxin biosynthesis (PF16073; HMM-score: 11.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.008938
- TAT(Tat/SPI): 0.000654
- LIPO(Sec/SPII): 0.000779
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446997363 NCBI
- RefSeq: WP_001074619 NCBI
- UniProt: see SAUSA300_0523
⊟Protein sequence[edit | edit source]
- MAKKGKKYQEAASKVDRTQHYSVEEAIKLAKETSIANFDASVEVAFRLGIDTRKNDQQIRGAVVLPNGTGKSQSVLVFAKGDKIAEAEAAGADYVGEAEYVQKIQQGWFDFDVVVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTMDVKKAVEEIKAGKVEYRAEKAGIVHASIGKVSFTDEQLIENFNTLQDVLAKAKPSSAKGTYFKSVAVTTTMGPGVKIDTASFK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SAUSA300_RS10295 (gatA) glutamyl-tRNA(Gln) amidotransferase subunit A [1] (data from MRSA252) SAUSA300_RS01250 L-lactate dehydrogenase [1] (data from MRSA252) SAUSA300_RS01635 5'-nucleotidase, lipoprotein e(P4) family [1] (data from MRSA252) SAUSA300_RS01940 30S ribosomal protein S6 [1] (data from MRSA252) SAUSA300_RS01950 30S ribosomal protein S18 [1] (data from MRSA252) SAUSA300_RS02070 IMP dehydrogenase [1] (data from MRSA252) SAUSA300_RS02835 30S ribosomal protein S12 [1] (data from MRSA252) SAUSA300_RS02840 30S ribosomal protein S7 [1] (data from MRSA252) SAUSA300_RS02845 elongation factor G [1] (data from MRSA252) SAUSA300_RS02850 elongation factor Tu [1] (data from MRSA252) SAUSA300_RS04560 NADH dehydrogenase [1] (data from MRSA252) SAUSA300_RS04700 hypothetical protein [1] (data from MRSA252) SAUSA300_RS05135 bifunctional autolysin [1] (data from MRSA252) SAUSA300_RS05350 pyruvate dehydrogenase E1 component subunit alpha [1] (data from MRSA252) SAUSA300_RS05355 pyruvate dehydrogenase E1 component subunit beta [1] (data from MRSA252) SAUSA300_RS05360 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex [1] (data from MRSA252) SAUSA300_RS05365 dihydrolipoyl dehydrogenase [1] (data from MRSA252) SAUSA300_RS05855 cell division protein FtsZ [1] (data from MRSA252) SAUSA300_RS06135 50S ribosomal protein L19 [1] (data from MRSA252) SAUSA300_RS06220 30S ribosomal protein S2 [1] (data from MRSA252) SAUSA300_RS06310 30S ribosomal protein S15 [1] (data from MRSA252) SAUSA300_RS06430 glycerol-3-phosphate responsive antiterminator [1] (data from MRSA252) SAUSA300_RS06790 DNA topoisomerase 4 subunit A [1] (data from MRSA252) SAUSA300_RS07430 DNA-binding protein HU [1] (data from MRSA252) SAUSA300_RS08360 hypothetical protein [1] (data from MRSA252) SAUSA300_RS08370 30S ribosomal protein S21 [1] (data from MRSA252) SAUSA300_RS08730 50S ribosomal protein L21 [1] (data from MRSA252) SAUSA300_RS08865 50S ribosomal protein L20 [1] (data from MRSA252) SAUSA300_RS08875 translation initiation factor IF-3 [1] (data from MRSA252) SAUSA300_RS08950 isocitrate dehydrogenase (NADP(+)) [1] (data from MRSA252) SAUSA300_RS09015 universal stress protein [1] (data from MRSA252) SAUSA300_RS09040 universal stress protein UspA [1] (data from MRSA252) SAUSA300_RS09045 acetate kinase [1] (data from MRSA252) SAUSA300_RS09090 30S ribosomal protein S4 [1] (data from MRSA252) SAUSA300_RS09205 membrane protein [1] (data from MRSA252) SAUSA300_RS09210 DUF948 domain containing protein [1] (data from MRSA252) SAUSA300_RS09465 S-adenosylmethionine synthase [1] (data from MRSA252) SAUSA300_RS09800 foldase [1] (data from MRSA252) SAUSA300_RS10290 aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [1] (data from MRSA252) SAUSA300_RS10460 ABC transporter ATP-binding protein [1] (data from MRSA252) SAUSA300_RS11380 uracil phosphoribosyltransferase [1] (data from MRSA252) SAUSA300_RS11805 Asp23/Gls24 family envelope stress response protein [1] (data from MRSA252) SAUSA300_RS11985 30S ribosomal protein S9 [1] (data from MRSA252) SAUSA300_RS12025 30S ribosomal protein S11 [1] (data from MRSA252) SAUSA300_RS12065 30S ribosomal protein S5 [1] (data from MRSA252) SAUSA300_RS12070 50S ribosomal protein L18 [1] (data from MRSA252) SAUSA300_RS12090 50S ribosomal protein L5 [1] (data from MRSA252) SAUSA300_RS12110 50S ribosomal protein L29 [1] (data from MRSA252) SAUSA300_RS12115 50S ribosomal protein L16 [1] (data from MRSA252) SAUSA300_RS12120 30S ribosomal protein S3 [1] (data from MRSA252) SAUSA300_RS12125 50S ribosomal protein L22 [1] (data from MRSA252) SAUSA300_RS12130 30S ribosomal protein S19 [1] (data from MRSA252) SAUSA300_RS12140 50S ribosomal protein L23 [1] (data from MRSA252) SAUSA300_RS12145 50S ribosomal protein L4 [1] (data from MRSA252) SAUSA300_RS12150 50S ribosomal protein L3 [1] (data from MRSA252) SAUSA300_RS12315 molybdate ABC transporter substrate-binding protein [1] (data from MRSA252) SAUSA300_RS13745 pyruvate oxidase [1] (data from MRSA252) SAUSA300_RS14105 malate:quinone oxidoreductase [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 1.48 1.49 1.50 1.51 1.52 1.53 1.54 1.55 1.56 1.57 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)