From AureoWiki
Revision as of 18:18, 12 January 2016 by Robot (talk | contribs) (Created page with "<protect> <aureodatabase>NCBI date</aureodatabase> =Summary= * <aureodatabase>organism</aureodatabase> * <aureodatabase>locus</aureodatabase> * <aureodatabase>pan locus</aur...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS00405
  • symbol: SAUSA300_RS00405
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 89109..89243
  • length: 135
  • essential: unknown

Accession numbers[edit | edit source]

  • Gene ID:
  • gene Genbank : _

Phenotype[edit | edit source]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    TTGAAACTTCATTGGTATATTTACTATTTTTTGTCAATATCTGTAATTTTATTTATGATT
    ATTTATCATTACTTAGCTACGTCAATGACTGTTGATTATGAAATAACTGTTTCTATTGCA
    AAGTTACTTTTATAA
    60
    120
    135

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS00405
  • symbol: SAUSA300_RS00405
  • description: hypothetical protein
  • length: 44
  • theoretical pI: 7.66697
  • theoretical MW: 5321.43
  • GRAVY: 1.14545

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED:
  • PFAM:
    no clan defined CCSMST1; CCSMST1 family (PF15013; HMM-score: 11.7)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • interaction partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.125408
    • TAT(Tat/SPI): 0.000582
    • LIPO(Sec/SPII): 0.015424
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

  • GI: 487706396 NCBI
  • UniProt:
  • protein Genbank : _
  • RefSeq: WP_001790628 NCBI

Protein sequence[edit | edit source]

  • MKLHWYIYYFLSISVILFMIIYHYLATSMTVDYEITVSIAKLLL

Peptides[edit | edit source]

  • experimentally validated:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • sigma factors : _
  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]