From AureoWiki
Revision as of 07:35, 11 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "gene Genbank" to "gene RefSeq")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2328 [new locus tag: SAUSA300_RS12865 ]
  • pan locus tag?: SAUPAN005909000
  • symbol: SAUSA300_2328
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_2328 [new locus tag: SAUSA300_RS12865 ]
  • symbol: SAUSA300_2328
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2504190..2504546
  • length: 357
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAAAAAGAAAAAAGGTTTTGGTCTTGGTATTAGTTTAATCGCCATCATGTTAATTGTA
    TGTATTGTATTAGTAATCATGATGATGACTGGCGGAAAGAAAGATACATACTATGGAATT
    ATGAAAGATAATACTACTATTGAAAAAATGATTAGTGAAAAAGATGAAAGTATTGAAAAA
    AATGTTAAATTACCTTCAGATTCAGATGTTAAAGTTAAAAAAGGTGATTTTGTAATTGTT
    TATAAATTAGCAGATTCAGATAAAATTGTTAAAGTTAAAAAAGTTGACCATGACGATGTA
    CCACATGGTTTAATGATGAAAATTCATGACATGGGCAAAATGCACATGAAACACTAA
    60
    120
    180
    240
    300
    357

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_2328 [new locus tag: SAUSA300_RS12865 ]
  • symbol: SAUSA300_2328
  • description: hypothetical protein
  • length: 118
  • theoretical pI: 9.96512
  • theoretical MW: 13340.1
  • GRAVY: -0.111017

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG01108504: hypothetical protein
  • PFAM:
    no clan defined DUF4889; Domain of unknown function (DUF4889) (PF16230; HMM-score: 125.6)
    and 4 more
    NusG_II; NusG domain II (PF07009; HMM-score: 14.4)
    DUF1510; Protein of unknown function (DUF1510) (PF07423; HMM-score: 13.9)
    UPF0239; Uncharacterised protein family (UPF0239) (PF06783; HMM-score: 13.3)
    DHHC; DHHC palmitoyltransferase (PF01529; HMM-score: 12.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.096205
    • TAT(Tat/SPI): 0.000587
    • LIPO(Sec/SPII): 0.210827
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKKKKGFGLGISLIAIMLIVCIVLVIMMMTGGKKDTYYGIMKDNTTIEKMISEKDESIEKNVKLPSDSDVKVKKGDFVIVYKLADSDKIVKVKKVDHDDVPHGLMMKIHDMGKMHMKH

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]