NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_2194 [new locus tag: SAUSA300_RS12100 ]
- pan locus tag?: SAUPAN005692000
- symbol: rplN
- pan gene symbol?: rplN
- synonym:
- product: 50S ribosomal protein L14
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_2194 [new locus tag: SAUSA300_RS12100 ]
- symbol: rplN
- product: 50S ribosomal protein L14
- replicon: chromosome
- strand: -
- coordinates: 2365837..2366205
- length: 369
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3913593 NCBI
- RefSeq: YP_494829 NCBI
- BioCyc: see SAUSA300_RS12100
- MicrobesOnline: 1293709 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGATCCAACAAGAAACACGCTTGAAAGTAGCAGACAACTCTGGTGCTCGTGAAGTTCTT
ACAATCAAAGTATTAGGTGGATCTGGTCGTAAAACAGCAAACATCGGCGATGTTATCGTA
TGTACTGTTAAAAATGCAACACCAGGTGGCGTTGTTAAAAAAGGTGACGTTGTCAAAGCT
GTAATCGTACGTACTAAGTCAGGTGTTCGTCGTAATGACGGTTCATACATCAAATTTGAT
GAAAATGCATGTGTTATCATCCGTGATGACAAAGGCCCACGTGGTACTCGTATCTTCGGA
CCTGTTGCTCGTGAATTACGTGAAGGTAACTTCATGAAAATCGTATCATTAGCACCAGAA
GTACTTTAA60
120
180
240
300
360
369
⊟Protein[edit | edit source]
Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU
⊟General[edit | edit source]
- locus tag: SAUSA300_2194 [new locus tag: SAUSA300_RS12100 ]
- symbol: RplN
- description: 50S ribosomal protein L14
- length: 122
- theoretical pI: 10.7254
- theoretical MW: 13135.2
- GRAVY: -0.141803
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL14 (TIGR01067; HMM-score: 192.3)and 1 more50S ribosomal protein uL14 (TIGR03673; HMM-score: 96.6)
- TheSEED :
- LSU ribosomal protein L14p (L23e)
- PFAM: no clan defined Ribosomal_L14; Ribosomal protein L14p/L23e (PF00238; HMM-score: 180.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 10
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.091516
- TAT(Tat/SPI): 0.009224
- LIPO(Sec/SPII): 0.006493
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKNATPGGVVKKGDVVKAVIVRTKSGVRRNDGSYIKFDENACVIIRDDKGPRGTRIFGPVARELREGNFMKIVSLAPEVL
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SAUSA300_1657 (ackA) acetate kinase [1] (data from MRSA252) SAUSA300_2570 (arcA) arginine deiminase [1] (data from MRSA252) SAUSA300_2567 (arcC) carbamate kinase [1] (data from MRSA252) SAUSA300_2142 (asp23) alkaline shock protein 23 [1] (data from MRSA252) SAUSA300_1096 (carB) carbamoyl phosphate synthase large subunit [1] (data from MRSA252) SAUSA300_2477 (cidC) pyruvate oxidase [1] (data from MRSA252) SAUSA300_1540 (dnaK) molecular chaperone DnaK [1] (data from MRSA252) SAUSA300_0760 (eno) phosphopyruvate hydratase [1] (data from MRSA252) SAUSA300_1080 (ftsZ) cell division protein FtsZ [1] (data from MRSA252) SAUSA300_0532 (fusA) elongation factor G [1] (data from MRSA252) SAUSA300_1633 (gap) glyceraldehyde 3-phosphate dehydrogenase 2 [1] (data from MRSA252) SAUSA300_1640 (icd) isocitrate dehydrogenase [1] (data from MRSA252) SAUSA300_1330 (ilvA) threonine dehydratase [1] (data from MRSA252) SAUSA300_1162 (infB) translation initiation factor IF-2 [1] (data from MRSA252) SAUSA300_0190 (ipdC) indole-3-pyruvate decarboxylase [1] (data from MRSA252) SAUSA300_0996 (lpdA) dihydrolipoamide dehydrogenase [1] (data from MRSA252) SAUSA300_1730 (metK) S-adenosylmethionine synthetase [1] (data from MRSA252) SAUSA300_2541 (mqo) malate:quinone oxidoreductase [1] (data from MRSA252) SAUSA300_2089 (pdp) pyrimidine-nucleoside phosphorylase [1] (data from MRSA252) SAUSA300_0478 (prs) ribose-phosphate pyrophosphokinase [1] (data from MRSA252) SAUSA300_1644 (pyk) pyruvate kinase [1] (data from MRSA252) SAUSA300_0524 (rplJ) 50S ribosomal protein L10 [1] (data from MRSA252) SAUSA300_0525 (rplL) 50S ribosomal protein L7/L12 [1] (data from MRSA252) SAUSA300_2185 (rplO) 50S ribosomal protein L15 [1] (data from MRSA252) SAUSA300_1134 (rplS) 50S ribosomal protein L19 [1] (data from MRSA252) SAUSA300_2199 (rplV) 50S ribosomal protein L22 [1] (data from MRSA252) SAUSA300_2202 (rplW) 50S ribosomal protein L23 [1] (data from MRSA252) SAUSA300_2198 (rpsC) 30S ribosomal protein S3 [1] (data from MRSA252) SAUSA300_2187 (rpsE) 30S ribosomal protein S5 [1] (data from MRSA252) SAUSA300_2171 (rpsI) 30S ribosomal protein S9 [1] (data from MRSA252) SAUSA300_0562 (thiD) phosphomethylpyrimidine kinase [1] (data from MRSA252) SAUSA300_0533 (tuf) elongation factor Tu [1] (data from MRSA252) SAUSA300_0020 DNA-binding response regulator [1] (data from MRSA252) SAUSA300_0504 pyridoxal biosynthesis lyase PdxS [1] (data from MRSA252) SAUSA300_0658 LysR family transcriptional regulator [1] (data from MRSA252) SAUSA300_0716 ribonucleotide-diphosphate reductase subunit alpha [1] (data from MRSA252) SAUSA300_0844 hypothetical protein [1] (data from MRSA252) SAUSA300_0871 hypothetical protein [1] (data from MRSA252) SAUSA300_1652 hypothetical protein [1] (data from MRSA252) SAUSA300_1656 universal stress protein [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)