NCBI date : _
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1603 [new locus tag: SAUSA300_RS08730 ]
- pan locus tag?: SAUPAN004253000
- symbol: rplU
- pan gene symbol?: rplU
- synonym:
- product: 50S ribosomal protein L21
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1603 [new locus tag: SAUSA300_RS08730 ]
- symbol: rplU
- product: 50S ribosomal protein L21
- replicon: chromosome
- strand: -
- coordinates: 1755990..1756298
- length: 309
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
- Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGTTTGCTATTATTGAAACAGGTGGAAAACAAATCAAAGTAGAAGAAGGTCAAGAAATC
TTCGTTGAAAAATTAGACGTAAACGAAGGAGATACTTTTACATTTGATAAAGTATTATTT
GTAGGTGGAGATTCAGTTAAAGTTGGAGCGCCAACAGTTGAAGGTGCAACAGTTACTGCT
ACTGTTAATAAACAAGGTCGCGGTAAAAAAATCACTGTATTCACATACAAACGTCGTAAA
AATTCAAAACGTAAAAAAGGCCATCGTCAACCATACACTAAATTAACAATCGATAAAATC
AACGCGTAA60
120
180
240
300
309
⊟Protein[edit | edit source]
Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU
⊟General[edit | edit source]
- locus tag: SAUSA300_1603 [new locus tag: SAUSA300_RS08730 ]
- symbol: RplU
- description: 50S ribosomal protein L21
- length: 102
- theoretical pI: 10.5589
- theoretical MW: 11333
- GRAVY: -0.557843
⊟Function[edit | edit source]
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- interaction partners:
SAUSA300_0760 (eno) phosphopyruvate hydratase [1] (data from MRSA252) SAUSA300_1362 (hup) DNA-binding protein HU [1] (data from MRSA252) SAUSA300_1162 (infB) translation initiation factor IF-2 [1] (data from MRSA252) SAUSA300_1627 (infC) translation initiation factor IF-3 [1] (data from MRSA252) SAUSA300_0523 (rplA) 50S ribosomal protein L1 [1] (data from MRSA252) SAUSA300_2201 (rplB) 50S ribosomal protein L2 [1] (data from MRSA252) SAUSA300_2204 (rplC) 50S ribosomal protein L3 [1] (data from MRSA252) SAUSA300_2203 (rplD) 50S ribosomal protein L4 [1] (data from MRSA252) SAUSA300_2192 (rplE) 50S ribosomal protein L5 [1] (data from MRSA252) SAUSA300_2189 (rplF) 50S ribosomal protein L6 [1] (data from MRSA252) SAUSA300_0524 (rplJ) 50S ribosomal protein L10 [1] (data from MRSA252) SAUSA300_0525 (rplL) 50S ribosomal protein L7/L12 [1] (data from MRSA252) SAUSA300_2172 (rplM) 50S ribosomal protein L13 [1] (data from MRSA252) SAUSA300_2185 (rplO) 50S ribosomal protein L15 [1] (data from MRSA252) SAUSA300_2177 (rplQ) 50S ribosomal protein L17 [1] (data from MRSA252) SAUSA300_1134 (rplS) 50S ribosomal protein L19 [1] (data from MRSA252) SAUSA300_1625 (rplT) 50S ribosomal protein L20 [1] (data from MRSA252) SAUSA300_2199 (rplV) 50S ribosomal protein L22 [1] (data from MRSA252) SAUSA300_2202 (rplW) 50S ribosomal protein L23 [1] (data from MRSA252) SAUSA300_2193 (rplX) 50S ribosomal protein L24 [1] (data from MRSA252) SAUSA300_2196 (rpmC) 50S ribosomal protein L29 [1] (data from MRSA252) SAUSA300_2074 (rpmE2) 50S ribosomal protein L31 type B [1] (data from MRSA252) SAUSA300_1149 (rpsB) 30S ribosomal protein S2 [1] (data from MRSA252) SAUSA300_2198 (rpsC) 30S ribosomal protein S3 [1] (data from MRSA252) SAUSA300_1666 (rpsD) 30S ribosomal protein S4 [1] (data from MRSA252) SAUSA300_2187 (rpsE) 30S ribosomal protein S5 [1] (data from MRSA252) SAUSA300_0366 (rpsF) 30S ribosomal protein S6 [1] (data from MRSA252) SAUSA300_2171 (rpsI) 30S ribosomal protein S9 [1] (data from MRSA252) SAUSA300_2179 (rpsK) 30S ribosomal protein S11 [1] (data from MRSA252) SAUSA300_1166 (rpsO) 30S ribosomal protein S15 [1] (data from MRSA252) SAUSA300_2195 (rpsQ) 30S ribosomal protein S17 [1] (data from MRSA252) SAUSA300_1305 (sucB) dihydrolipoamide succinyltransferase [1] (data from MRSA252) SAUSA300_0307 5'-nucleotidase [1] (data from MRSA252) SAUSA300_0531 30S ribosomal protein S7 [1] (data from MRSA252) SAUSA300_0658 LysR family transcriptional regulator [1] (data from MRSA252) SAUSA300_0668 hypothetical protein [1] (data from MRSA252) SAUSA300_0989 hypothetical protein [1] (data from MRSA252) SAUSA300_1652 hypothetical protein [1] (data from MRSA252) SAUSA300_2037 ATP-dependent RNA helicase [1] (data from MRSA252)
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009723
- TAT(Tat/SPI): 0.002794
- LIPO(Sec/SPII): 0.000832
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MFAIIETGGKQIKVEEGQEIFVEKLDVNEGDTFTFDKVLFVGGDSVKVGAPTVEGATVTATVNKQGRGKKITVFTYKRRKNSKRKKGHRQPYTKLTIDKINA
⊟Peptides[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- sigma factors : _
- data available for NCTC8325
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)