From AureoWiki
Revision as of 01:13, 11 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "gene Genbank" to "gene RefSeq")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1501 [new locus tag: SAUSA300_RS08200 ]
  • pan locus tag?: SAUPAN004120000
  • symbol: SAUSA300_1501
  • pan gene symbol?: comGD
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_1501 [new locus tag: SAUSA300_RS08200 ]
  • symbol: SAUSA300_1501
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1654322..1654768
  • length: 447
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGGAGAAGCAGTTGCAAATTAGAAAGCAGTCAGCATTTACTATGATTGAGATGCTTGTG
    GTAATGATGTTAATCAGTATATTTCTACTTTTGACAATGACATCTAAAGGATTAAGCAAT
    CTTAGAGTAATAGATGATGAGGCAAATATCATTTCTTTTATTACTGAATTGAATTATATT
    AAGTCGCAAGCTATAGCAAATCAAGGATATATCAATGTTAGATTTTATGAAAACAGTGAC
    ACTATTAAAGTAATAGAGAATAATAATATACGATTTCTAAAATTAAAAGTAGGCAAAATA
    ATTAATGTTGCAAAAGTTGATATTATTGCCTTTGATAAAAAAGGGAATATCAATAAATTT
    GGTAGCATAACAATTTACAATAACAATTCAATTTATAGAATAATATTCCATATTGAAAAA
    GGAAGAATTCGTTATGAAAAGCTATAA
    60
    120
    180
    240
    300
    360
    420
    447

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_1501 [new locus tag: SAUSA300_RS08200 ]
  • symbol: SAUSA300_1501
  • description: hypothetical protein
  • length: 148
  • theoretical pI: 10.2928
  • theoretical MW: 17199.2
  • GRAVY: 0.0972973

Function[edit | edit source]

  • TIGRFAM:
    Cell structure Cell envelope Surface structures Verru_Chthon cassette protein D (TIGR02596; HMM-score: 29.2)
    Cell structure Cell envelope Surface structures prepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 24.6)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking prepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 24.6)
    and 5 more
    Cellular processes Cellular processes Pathogenesis type II secretion system protein H (TIGR01708; HMM-score: 19.3)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type II secretion system protein H (TIGR01708; HMM-score: 19.3)
    Cell structure Cell envelope Surface structures type IV pilus modification protein PilV (TIGR02523; HMM-score: 13)
    Genetic information processing Protein fate Protein modification and repair type IV pilus modification protein PilV (TIGR02523; HMM-score: 13)
    Cell structure Cell envelope Surface structures Verru_Chthon cassette protein C (TIGR02599; HMM-score: 11.5)
  • TheSEED  :
    • Late competence protein ComGD, access of DNA to ComEA, FIG012777
    DNA Metabolism DNA uptake, competence Late competence  Late competence protein ComGD, access of DNA to ComEA, FIG012777
  • PFAM:
    no clan defined N_methyl; Prokaryotic N-terminal methylation motif (PF07963; HMM-score: 27.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0.5
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.275053
    • TAT(Tat/SPI): 0.006525
    • LIPO(Sec/SPII): 0.036629
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MEKQLQIRKQSAFTMIEMLVVMMLISIFLLLTMTSKGLSNLRVIDDEANIISFITELNYIKSQAIANQGYINVRFYENSDTIKVIENNNIRFLKLKVGKIINVAKVDIIAFDKKGNINKFGSITIYNNNSIYRIIFHIEKGRIRYEKL

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • data available for N315

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]