Jump to navigation
Jump to search
m (Text replacement - "gene Genbank" to "gene RefSeq") |
m (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "") |
||
Line 1: | Line 1: | ||
__TOC__ | |||
<protect> | <protect> | ||
<aureodatabase> | <aureodatabase>annotation</aureodatabase> | ||
=Summary= | =Summary= | ||
* <aureodatabase>organism</aureodatabase> | *<aureodatabase>organism</aureodatabase> | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>pan locus</aureodatabase> | *<aureodatabase>pan locus</aureodatabase> | ||
* <aureodatabase>gene symbol</aureodatabase> | *<aureodatabase>gene symbol</aureodatabase> | ||
* <aureodatabase>pan gene symbol</aureodatabase> | *<aureodatabase>pan gene symbol</aureodatabase> | ||
* <aureodatabase>gene synonyms</aureodatabase> | *<aureodatabase>gene synonyms</aureodatabase> | ||
* <aureodatabase>product</aureodatabase> | *<aureodatabase>product</aureodatabase> | ||
</protect> | </protect> | ||
Line 24: | Line 25: | ||
==General== | ==General== | ||
* <aureodatabase>gene type</aureodatabase> | *<aureodatabase>gene type</aureodatabase> | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>gene symbol</aureodatabase> | *<aureodatabase>gene symbol</aureodatabase> | ||
* <aureodatabase>product</aureodatabase> | *<aureodatabase>product</aureodatabase> | ||
* <aureodatabase>gene replicon</aureodatabase> | *<aureodatabase>gene replicon</aureodatabase> | ||
* <aureodatabase>strand</aureodatabase> | *<aureodatabase>strand</aureodatabase> | ||
* <aureodatabase>gene coordinates</aureodatabase> | *<aureodatabase>gene coordinates</aureodatabase> | ||
* <aureodatabase>gene length</aureodatabase> | *<aureodatabase>gene length</aureodatabase> | ||
* <aureodatabase>essential</aureodatabase> | *<aureodatabase>essential</aureodatabase> | ||
*<aureodatabase>gene comment</aureodatabase> | |||
</protect> | </protect> | ||
Line 38: | Line 40: | ||
==Accession numbers== | ==Accession numbers== | ||
* <aureodatabase>gene GI</aureodatabase> | *<aureodatabase>gene GI</aureodatabase> | ||
* <aureodatabase>gene RefSeq</aureodatabase> | *<aureodatabase>gene RefSeq</aureodatabase> | ||
*<aureodatabase>gene BioCyc</aureodatabase> | |||
*<aureodatabase>gene MicrobesOnline</aureodatabase> | |||
</protect> | </protect> | ||
<protect> | <protect> | ||
==Phenotype== | ==Phenotype== | ||
</protect> | </protect> | ||
Share your knowledge and add information here. [<span class="plainlinks">[//aureowiki.med.uni-greifswald.de/index.php?title={{PAGENAMEE}}&veaction=edit§ion=6 edit]</span>] | |||
<protect> | <protect> | ||
==DNA sequence== | ==DNA sequence== | ||
* <aureodatabase>gene sequence</aureodatabase> | *<aureodatabase>gene sequence</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
<aureodatabase>RNA regulated operons</aureodatabase> | |||
</protect> | |||
<protect> | |||
=Protein= | =Protein= | ||
<aureodatabase>protein 3D view</aureodatabase> | <aureodatabase>protein 3D view</aureodatabase> | ||
==General== | ==General== | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>protein symbol</aureodatabase> | *<aureodatabase>protein symbol</aureodatabase> | ||
* <aureodatabase>protein description</aureodatabase> | *<aureodatabase>protein description</aureodatabase> | ||
* <aureodatabase>protein length</aureodatabase> | *<aureodatabase>protein length</aureodatabase> | ||
* <aureodatabase>theoretical pI</aureodatabase> | *<aureodatabase>theoretical pI</aureodatabase> | ||
* <aureodatabase>theoretical MW</aureodatabase> | *<aureodatabase>theoretical MW</aureodatabase> | ||
* <aureodatabase>GRAVY</aureodatabase> | *<aureodatabase>GRAVY</aureodatabase> | ||
</protect> | </protect> | ||
Line 71: | Line 78: | ||
==Function== | ==Function== | ||
* <aureodatabase>protein reaction</aureodatabase> | *<aureodatabase>protein reaction</aureodatabase> | ||
* <aureodatabase>protein TIGRFAM</aureodatabase> | *<aureodatabase>protein TIGRFAM</aureodatabase> | ||
* <aureodatabase>protein TheSeed</aureodatabase> | *<aureodatabase>protein TheSeed</aureodatabase> | ||
* <aureodatabase>protein PFAM</aureodatabase> | *<aureodatabase>protein PFAM</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
==Structure, modifications & | ==Structure, modifications & cofactors== | ||
* <aureodatabase>protein domains</aureodatabase> | *<aureodatabase>protein domains</aureodatabase> | ||
* <aureodatabase>protein modifications</aureodatabase> | *<aureodatabase>protein modifications</aureodatabase> | ||
* <aureodatabase>protein cofactors</aureodatabase> | *<aureodatabase>protein cofactors</aureodatabase> | ||
* <aureodatabase>protein effectors</aureodatabase> | *<aureodatabase>protein effectors</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein regulated operons</aureodatabase> | ||
</protect> | </protect> | ||
Line 90: | Line 97: | ||
==Localization== | ==Localization== | ||
* <aureodatabase>protein Psortb</aureodatabase> | *<aureodatabase>protein Psortb</aureodatabase> | ||
* <aureodatabase>protein LocateP</aureodatabase> | *<aureodatabase>protein LocateP</aureodatabase> | ||
* <aureodatabase>protein SignalP</aureodatabase> | *<aureodatabase>protein SignalP</aureodatabase> | ||
* <aureodatabase>protein TMHMM</aureodatabase> | *<aureodatabase>protein TMHMM</aureodatabase> | ||
</protect> | </protect> | ||
Line 99: | Line 106: | ||
==Accession numbers== | ==Accession numbers== | ||
* <aureodatabase>protein GI</aureodatabase> | *<aureodatabase>protein GI</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein RefSeq</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein UniProt</aureodatabase> | ||
</protect> | </protect> | ||
Line 108: | Line 114: | ||
==Protein sequence== | ==Protein sequence== | ||
* <aureodatabase>protein sequence</aureodatabase> | *<aureodatabase>protein sequence</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
== | ==Experimental data== | ||
* <aureodatabase>protein validated peptides</aureodatabase> | *<aureodatabase>protein validated peptides</aureodatabase> | ||
*<aureodatabase>protein validated localization</aureodatabase> | |||
*<aureodatabase>protein validated quantitative data</aureodatabase> | |||
*<aureodatabase>protein partners</aureodatabase> | |||
</protect> | </protect> | ||
Line 125: | Line 134: | ||
==Operon== | ==Operon== | ||
* <aureodatabase>operons</aureodatabase> | *<aureodatabase>operons</aureodatabase> | ||
</protect> | </protect> | ||
Line 131: | Line 140: | ||
==Regulation== | ==Regulation== | ||
*<aureodatabase>regulators</aureodatabase> | |||
* <aureodatabase>regulators</aureodatabase> | |||
</protect> | </protect> | ||
Line 138: | Line 146: | ||
==Transcription pattern== | ==Transcription pattern== | ||
* <aureodatabase>expression browser</aureodatabase> | *<aureodatabase>expression browser</aureodatabase> | ||
</protect> | </protect> | ||
Line 144: | Line 152: | ||
==Protein synthesis (provided by Aureolib)== | ==Protein synthesis (provided by Aureolib)== | ||
* <aureodatabase>protein synthesis Aureolib</aureodatabase> | *<aureodatabase>protein synthesis Aureolib</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
== | ==Protein stability== | ||
* <aureodatabase>protein half-life</aureodatabase> | *<aureodatabase>protein half-life</aureodatabase> | ||
</protect> | </protect> | ||
Latest revision as of 08:44, 11 March 2016
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1288 [new locus tag: SAUSA300_RS07000 ]
- pan locus tag?: SAUPAN003808000
- symbol: dapA
- pan gene symbol?: dapA
- synonym:
- product: dihydrodipicolinate synthase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1288 [new locus tag: SAUSA300_RS07000 ]
- symbol: dapA
- product: dihydrodipicolinate synthase
- replicon: chromosome
- strand: +
- coordinates: 1419064..1419951
- length: 888
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3914419 NCBI
- RefSeq: YP_493985 NCBI
- BioCyc: GH3C-1283 BioCyc
- MicrobesOnline: 1292803 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721
781
841ATGACACATTTATTTGAGGGTGTTGGCGTTGCACTTACAACCCCTTTTACAAATAACAAA
GTTAATATTGAAGCTTTGAAAACACACGTTAATTTTTTACTAGAAAATAATGCCCAAGCA
ATCATCGTTAATGGAACTACTGCTGAGAGCCCTACTTTAACAACAGATGAAAAAGAACGC
ATTCTAAAAACAGTTATTGATCTTGTAGATAAACGTGTTCCTGTCATAGCAGGAACTGGC
ACTAATGATACTGAAAAGTCAATCCAAGCTTCAATCCAAGCTAAAGCCTTAGGGGCTGAT
GCAATTATGTTAATTACGCCCTACTACAACAAAACGAACCAACGTGGTTTAGTCAAACAC
TTTGAAGCGATTGCAGATGCTGTGAAATTACCAGTCGTGCTGTACAATGTTCCTTCAAGA
ACGAACATGACAATTGAACCAGAAACTGTAGAAATATTAAGTCAACATCCTTATATAGTT
GCTTTAAAAGATGCTACGAATGATTTTGAGTATTTAGAAGAAGTGAAAAAGCGCATTGAT
ACAAATTCATTTGCATTATATAGTGGCAATGATGACAACGTCGTCGAATACTATCAACGT
GGCGGTCAAGGGGTTATCTCTGTTATTGCCAATGTCATTCCTAAAGAATTTCAAGCGTTA
TACGATGCTCAACAAAGTGGATTAGATATTCAAGATCAATTTAAACCAATCGGCACACTG
TTATCAGCTTTATCAGTTGATATTAACCCAATTCCTATTAAAGCTCTAACAAGTTATTTA
GGATTTGGAAATTATGAATTACGTCTACCATTGGTTAGCCTAGAAGATACAGATACTAAA
GTGCTTCGTGAAACATATGACACATTTAAAGCGGGTGAAAATGAGTGA60
120
180
240
300
360
420
480
540
600
660
720
780
840
888
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_1288 [new locus tag: SAUSA300_RS07000 ]
- symbol: DapA
- description: dihydrodipicolinate synthase
- length: 295
- theoretical pI: 4.5405
- theoretical MW: 32583.7
- GRAVY: -0.155254
⊟Function[edit | edit source]
- reaction: EC 4.3.3.7? ExPASy4-hydroxy-tetrahydrodipicolinate synthase Pyruvate + L-aspartate-4-semialdehyde = (4S)-4-hydroxy-2,3,4,5-tetrahydro-(2S)-dipicolinate + H2OEC 4.2.1.52? ExPASyTransferred entry: 4.3.3.7
- TIGRFAM: Amino acid biosynthesis Aspartate family 4-hydroxy-tetrahydrodipicolinate synthase (TIGR00674; EC 4.3.3.7; HMM-score: 282)and 6 more2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase (TIGR02313; EC 4.1.2.-; HMM-score: 193.2)5-dehydro-4-deoxyglucarate dehydratase (TIGR03249; EC 4.2.1.41; HMM-score: 110.3)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides N-acetylneuraminate lyase (TIGR00683; EC 4.1.3.3; HMM-score: 96.8)Central intermediary metabolism Amino sugars N-acetylneuraminate lyase (TIGR00683; EC 4.1.3.3; HMM-score: 96.8)Hypothetical proteins Conserved TIGR01244 family protein (TIGR01244; HMM-score: 13.8)Amino acid biosynthesis Serine family putative phosphoserine aminotransferase (TIGR01366; EC 2.6.1.52; HMM-score: 13.2)
- TheSEED :
- 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7)
- PFAM: TIM_barrel (CL0036) DHDPS; Dihydrodipicolinate synthetase family (PF00701; HMM-score: 250.8)and 3 moreTubulin_C (CL0442) FtsZ_C; FtsZ family, C-terminal domain (PF12327; HMM-score: 15.3)TIM_barrel (CL0036) NMO; Nitronate monooxygenase (PF03060; HMM-score: 13.6)SIS (CL0067) SIS; SIS domain (PF01380; HMM-score: 13.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009594
- TAT(Tat/SPI): 0.000492
- LIPO(Sec/SPII): 0.000627
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTHLFEGVGVALTTPFTNNKVNIEALKTHVNFLLENNAQAIIVNGTTAESPTLTTDEKERILKTVIDLVDKRVPVIAGTGTNDTEKSIQASIQAKALGADAIMLITPYYNKTNQRGLVKHFEAIADAVKLPVVLYNVPSRTNMTIEPETVEILSQHPYIVALKDATNDFEYLEEVKKRIDTNSFALYSGNDDNVVEYYQRGGQGVISVIANVIPKEFQALYDAQQSGLDIQDQFKPIGTLLSALSVDINPIPIKALTSYLGFGNYELRLPLVSLEDTDTKVLRETYDTFKAGENE
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SAUSA300_1246 (acnA) aconitate hydratase [1] (data from MRSA252) SAUSA300_2183 (adk) adenylate kinase [1] (data from MRSA252) SAUSA300_2569 (arcB) ornithine carbamoyltransferase [1] (data from MRSA252) SAUSA300_1345 (asnC) asparaginyl-tRNA synthetase [1] (data from MRSA252) SAUSA300_1096 (carB) carbamoyl phosphate synthase large subunit [1] (data from MRSA252) SAUSA300_2477 (cidC) pyruvate oxidase [1] (data from MRSA252) SAUSA300_0491 (cysK) cysteine synthase A [1] (data from MRSA252) SAUSA300_2091 (deoD) purine nucleoside phosphorylase [1] (data from MRSA252) SAUSA300_0837 (dltC) D-alanine--poly(phosphoribitol) ligase subunit 2 [1] (data from MRSA252) SAUSA300_0760 (eno) phosphopyruvate hydratase [1] (data from MRSA252) SAUSA300_0570 (eutD) phosphotransacetylase [1] (data from MRSA252) SAUSA300_1678 (fhs) formate--tetrahydrofolate ligase [1] (data from MRSA252) SAUSA300_0965 (folD) bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase [1] (data from MRSA252) SAUSA300_1080 (ftsZ) cell division protein FtsZ [1] (data from MRSA252) SAUSA300_0532 (fusA) elongation factor G [1] (data from MRSA252) SAUSA300_0756 (gap) glyceraldehyde-3-phosphate dehydrogenase, type I [1] (data from MRSA252) SAUSA300_1880 (gatB) aspartyl/glutamyl-tRNA amidotransferase subunit B [1] (data from MRSA252) SAUSA300_2104 (glmS) glucosamine--fructose-6-phosphate aminotransferase [1] (data from MRSA252) SAUSA300_1201 (glnA) glutamine synthetase, type I [1] (data from MRSA252) SAUSA300_2362 (gpmA) phosphoglyceromutase [1] (data from MRSA252) SAUSA300_0759 (gpmI) phosphoglyceromutase [1] (data from MRSA252) SAUSA300_1982 (groEL) chaperonin GroEL [1] (data from MRSA252) SAUSA300_1983 (groES) co-chaperonin GroES [1] (data from MRSA252) SAUSA300_0389 (guaA) GMP synthase [1] (data from MRSA252) SAUSA300_0388 (guaB) inosine-5'-monophosphate dehydrogenase [1] (data from MRSA252) SAUSA300_0861 (gudB) NAD-specific glutamate dehydrogenase [1] (data from MRSA252) SAUSA300_1362 (hup) DNA-binding protein HU [1] (data from MRSA252) SAUSA300_1640 (icd) isocitrate dehydrogenase [1] (data from MRSA252) SAUSA300_1162 (infB) translation initiation factor IF-2 [1] (data from MRSA252) SAUSA300_0996 (lpdA) dihydrolipoamide dehydrogenase [1] (data from MRSA252) SAUSA300_2541 (mqo) malate:quinone oxidoreductase [1] (data from MRSA252) SAUSA300_1316 (msrB) methionine sulfoxide reductase B [1] (data from MRSA252) SAUSA300_1358 (ndk) nucleoside diphosphate kinase [1] (data from MRSA252) SAUSA300_1159 (nusA) transcription elongation factor NusA [1] (data from MRSA252) SAUSA300_1731 (pckA) phosphoenolpyruvate carboxykinase [1] (data from MRSA252) SAUSA300_0993 (pdhA) pyruvate dehydrogenase E1 component, alpha subunit [1] (data from MRSA252) SAUSA300_0994 (pdhB) pyruvate dehydrogenase E1 component, beta subunit [1] (data from MRSA252) SAUSA300_2089 (pdp) pyrimidine-nucleoside phosphorylase [1] (data from MRSA252) SAUSA300_0220 (pflB) formate acetyltransferase [1] (data from MRSA252) SAUSA300_0865 (pgi) glucose-6-phosphate isomerase [1] (data from MRSA252) SAUSA300_0757 (pgk) phosphoglycerate kinase [1] (data from MRSA252) SAUSA300_1900 (ppaC) putative manganese-dependent inorganic pyrophosphatase [1] (data from MRSA252) SAUSA300_0983 (ptsH) phosphocarrier protein HPr [1] (data from MRSA252) SAUSA300_0984 (ptsI) phosphoenolpyruvate-protein phosphotransferase [1] (data from MRSA252) SAUSA300_1644 (pyk) pyruvate kinase [1] (data from MRSA252) SAUSA300_1094 (pyrC) dihydroorotase [1] (data from MRSA252) SAUSA300_0523 (rplA) 50S ribosomal protein L1 [1] (data from MRSA252) SAUSA300_2201 (rplB) 50S ribosomal protein L2 [1] (data from MRSA252) SAUSA300_2204 (rplC) 50S ribosomal protein L3 [1] (data from MRSA252) SAUSA300_2203 (rplD) 50S ribosomal protein L4 [1] (data from MRSA252) SAUSA300_2192 (rplE) 50S ribosomal protein L5 [1] (data from MRSA252) SAUSA300_2189 (rplF) 50S ribosomal protein L6 [1] (data from MRSA252) SAUSA300_0524 (rplJ) 50S ribosomal protein L10 [1] (data from MRSA252) SAUSA300_2172 (rplM) 50S ribosomal protein L13 [1] (data from MRSA252) SAUSA300_2185 (rplO) 50S ribosomal protein L15 [1] (data from MRSA252) SAUSA300_2177 (rplQ) 50S ribosomal protein L17 [1] (data from MRSA252) SAUSA300_1134 (rplS) 50S ribosomal protein L19 [1] (data from MRSA252) SAUSA300_1603 (rplU) 50S ribosomal protein L21 [1] (data from MRSA252) SAUSA300_2199 (rplV) 50S ribosomal protein L22 [1] (data from MRSA252) SAUSA300_2202 (rplW) 50S ribosomal protein L23 [1] (data from MRSA252) SAUSA300_2193 (rplX) 50S ribosomal protein L24 [1] (data from MRSA252) SAUSA300_2074 (rpmE2) 50S ribosomal protein L31 type B [1] (data from MRSA252) SAUSA300_0527 (rpoB) DNA-directed RNA polymerase subunit beta [1] (data from MRSA252) SAUSA300_0528 (rpoC) DNA-directed RNA polymerase subunit beta' [1] (data from MRSA252) SAUSA300_2198 (rpsC) 30S ribosomal protein S3 [1] (data from MRSA252) SAUSA300_1666 (rpsD) 30S ribosomal protein S4 [1] (data from MRSA252) SAUSA300_2187 (rpsE) 30S ribosomal protein S5 [1] (data from MRSA252) SAUSA300_0366 (rpsF) 30S ribosomal protein S6 [1] (data from MRSA252) SAUSA300_2171 (rpsI) 30S ribosomal protein S9 [1] (data from MRSA252) SAUSA300_2179 (rpsK) 30S ribosomal protein S11 [1] (data from MRSA252) SAUSA300_1131 (rpsP) 30S ribosomal protein S16 [1] (data from MRSA252) SAUSA300_2200 (rpsS) 30S ribosomal protein S19 [1] (data from MRSA252) SAUSA300_1306 (sucA) 2-oxoglutarate dehydrogenase E1 component [1] (data from MRSA252) SAUSA300_1305 (sucB) dihydrolipoamide succinyltransferase [1] (data from MRSA252) SAUSA300_1138 (sucC) succinyl-CoA synthetase subunit beta [1] (data from MRSA252) SAUSA300_1622 (tig) trigger factor [1] (data from MRSA252) SAUSA300_1044 (trx) thioredoxin [1] (data from MRSA252) SAUSA300_1150 (tsf) elongation factor Ts [1] (data from MRSA252) SAUSA300_0533 (tuf) elongation factor Tu [1] (data from MRSA252) SAUSA300_0113 immunoglobulin G binding protein A [1] (data from MRSA252) SAUSA300_0170 aldehyde dehydrogenase [1] (data from MRSA252) SAUSA300_0235 L-lactate dehydrogenase [1] (data from MRSA252) SAUSA300_0355 acetyl-CoA acetyltransferase [1] (data from MRSA252) SAUSA300_0385 hypothetical protein [1] (data from MRSA252) SAUSA300_0479 50S ribosomal protein L25/general stress protein Ctc [1] (data from MRSA252) SAUSA300_0504 pyridoxal biosynthesis lyase PdxS [1] (data from MRSA252) SAUSA300_0531 30S ribosomal protein S7 [1] (data from MRSA252) SAUSA300_0555 putative hexulose-6-phosphate synthase [1] (data from MRSA252) SAUSA300_0618 ABC transporter substrate-binding protein [1] (data from MRSA252) SAUSA300_0655 hypothetical protein [1] (data from MRSA252) SAUSA300_0789 putative thioredoxin [1] (data from MRSA252) SAUSA300_0790 hypothetical protein [1] (data from MRSA252) SAUSA300_0844 hypothetical protein [1] (data from MRSA252) SAUSA300_0871 hypothetical protein [1] (data from MRSA252) SAUSA300_0916 hypothetical protein [1] (data from MRSA252) SAUSA300_0989 hypothetical protein [1] (data from MRSA252) SAUSA300_0995 branched-chain alpha-keto acid dehydrogenase subunit E2 [1] (data from MRSA252) SAUSA300_1232 catalase [1] (data from MRSA252) SAUSA300_1496 glycine dehydrogenase subunit 2 [1] (data from MRSA252) SAUSA300_1497 glycine dehydrogenase subunit 1 [1] (data from MRSA252) SAUSA300_1572 hypothetical protein [1] (data from MRSA252) SAUSA300_1652 hypothetical protein [1] (data from MRSA252) SAUSA300_1656 universal stress protein [1] (data from MRSA252) SAUSA300_1697 dipeptidase PepV [1] (data from MRSA252) SAUSA300_1725 putative translaldolase [1] (data from MRSA252) SAUSA300_1874 ferritins family protein [1] (data from MRSA252) SAUSA300_1909 hypothetical protein [1] (data from MRSA252) SAUSA300_2254 glycerate dehydrogenase-like protein [1] (data from MRSA252) SAUSA300_2484 hydroxymethylglutaryl-CoA synthase [1] (data from MRSA252) SAUSA300_2491 1-pyrroline-5-carboxylate dehydrogenase [1] (data from MRSA252) SAUSA300_2537 L-lactate dehydrogenase [1] (data from MRSA252) SAUSA300_2540 fructose-1,6-bisphosphate aldolase [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SAUSA300_1286 > asd > dapA > dapB > dapD
⊟Regulation[edit | edit source]
- regulators: L-box (transcription termination) regulon, CodY (repression) regulon
L-box (RNA) important in Lysine biosynthesis; transcription unit transferred from N315 data RegPrecise CodY (TF) important in Amino acid metabolism; RegPrecise transcription unit transferred from N315 data RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.000 1.001 1.002 1.003 1.004 1.005 1.006 1.007 1.008 1.009 1.010 1.011 1.012 1.013 1.014 1.015 1.016 1.017 1.018 1.019 1.020 1.021 1.022 1.023 1.024 1.025 1.026 1.027 1.028 1.029 1.030 1.031 1.032 1.033 1.034 1.035 1.036 1.037 1.038 1.039 1.040 1.041 1.042 1.043 1.044 1.045 1.046 1.047 1.048 1.049 1.050 1.051 1.052 1.053 1.054 1.055 1.056 1.057 1.058 1.059 1.060 1.061 1.062 1.063 1.064 1.065 1.066 1.067 1.068 1.069 1.070 1.071 1.072 1.073 1.074 1.075 1.076 1.077 1.078 1.079 1.080 1.081 1.082 1.083 1.084 1.085 1.086 1.087 1.088 1.089 1.090 1.091 1.092 1.093 1.094 1.095 1.096 1.097 1.098 1.099 1.100 1.101 1.102 1.103 1.104 1.105 1.106 1.107 1.108 1.109 1.110 1.111 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)