NCBI date : _
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1273 [new locus tag: SAUSA300_RS06910 ]
- pan locus tag?: SAUPAN003784000
- symbol: opp-2F
- pan gene symbol?: nikE
- synonym: opp2F
- product: oligopeptide permease, ATP-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1273 [new locus tag: SAUSA300_RS06910 ]
- symbol: opp-2F
- product: oligopeptide permease, ATP-binding protein
- replicon: chromosome
- strand: -
- coordinates: 1401687..1402388
- length: 702
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
- Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661ATGATTGAGTTAAAACATGTGACTTTTGGTTATAATAAAAAGCAGATGGTGCTACAAGAT
ATCAATATTACTATACCTGATGGAGAAAATGTTGGTATTTTAGGCGAAAGTGGCTGTGGT
AAAAGTACGCTCGCTTCATTGGTTCTTGGCTTGTTTAAACCTGTTAAAGGAGAGATTTAC
TTAAGTGACAATGCTGTGTTACCGATTTTCCAACACCCTTTAACTAGCTTTAACCCTGAT
TGGACGATTGAGACCTCATTAAAAGAAGCGTTATATTATTACAGAGGTCTAACTGATAAT
ACTGCTCAGGATCAATTATTATTACAACATTTATCTACTTTTGAGTTAAACGCGCAATTA
TTGACTAAATTACCAAGCGAAGTGAGTGGCGGACAATTACAAAGATTTAATGTCATGCGT
TCGTTATTAGCACAGCCTCGCGTTTTAATATGTGATGAGATAACTTCAAATTTAGATGTT
ATAGCTGAACAAAATGTAATCAATATATTAAAAGCGCAAACGATTACGAACTTAAATCAT
TTTATCGTTATTTCTCATGATTTATCCGTGTTACAACGCTTAGTTAATAGAATTATCGTT
CTTAAGGATGGCATGATAGTCGATGATTTTGCAATAGAGGAATTATTTAATGTTGATAGA
CACCCTTATACAAAAGAATTAGTGCAAGCATTTTCATATTAG60
120
180
240
300
360
420
480
540
600
660
702
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_1273 [new locus tag: SAUSA300_RS06910 ]
- symbol: Opp-2F
- description: oligopeptide permease, ATP-binding protein
- length: 233
- theoretical pI: 5.04971
- theoretical MW: 26257.1
- GRAVY: 0.0802575
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 168.7)and 75 moreTransport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 134.8)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 124.5)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 124.5)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 116)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 116)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 115.6)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 113.5)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 113.5)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 113.1)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 106.2)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 106.2)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 106.2)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 104.4)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 104.3)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 99.1)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 97.2)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 95.2)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 94.8)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 94.1)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 93.6)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 93.1)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 92.9)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 92.7)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 91.8)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 91.8)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 90.7)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 90.3)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 90.3)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 88.9)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 86.7)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 85.5)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 84.9)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 79.9)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 79.7)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 79.7)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 79.7)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 78.7)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 78.4)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 76)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 74.8)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 70.2)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 69.5)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 69.2)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 67.3)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 67.3)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 66.9)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 66.6)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 65.6)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 64.7)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 64.7)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 63.8)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 62.8)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 62.8)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 62.1)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 61.6)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 59.9)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 59.6)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 59.6)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 58.6)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 58.6)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 58.6)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 57.3)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 56.5)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 51.4)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 50.3)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 46.1)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 39.2)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 24.3)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 23.5)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 18.6)Cellular processes Pathogenesis type III secretion apparatus H+-transporting two-sector ATPase (TIGR02546; EC 3.6.3.14; HMM-score: 14.6)Protein fate Protein and peptide secretion and trafficking type III secretion apparatus H+-transporting two-sector ATPase (TIGR02546; EC 3.6.3.14; HMM-score: 14.6)Transport and binding proteins Amino acids, peptides and amines oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain (TIGR01727; HMM-score: 14.5)Cellular processes Chemotaxis and motility flagellar protein export ATPase FliI (TIGR03497; EC 3.6.3.14; HMM-score: 11.8)Cellular processes Chemotaxis and motility flagellar protein export ATPase FliI (TIGR03496; EC 3.6.3.14; HMM-score: 11.1)
- TheSEED :
- ABC-type dipeptide/oligopeptide/nickel transport system, ATP-binding protein
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 81.4)and 15 moreSMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 19.4)AAA_16; AAA ATPase domain (PF13191; HMM-score: 19.4)AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 17.3)AAA_22; AAA domain (PF13401; HMM-score: 16.1)AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 14.9)IstB_IS21; IstB-like ATP binding protein (PF01695; HMM-score: 14.3)AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 14)Sigma54_activat; Sigma-54 interaction domain (PF00158; HMM-score: 13.9)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 13.6)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 13.2)no clan defined oligo_HPY; Oligopeptide/dipeptide transporter, C-terminal region (PF08352; HMM-score: 13.2)P-loop_NTPase (CL0023) RNA_helicase; RNA helicase (PF00910; HMM-score: 12.7)Mg_chelatase; Magnesium chelatase, subunit ChlI (PF01078; HMM-score: 12.3)PRK; Phosphoribulokinase / Uridine kinase family (PF00485; HMM-score: 12.1)ATP-synt_ab; ATP synthase alpha/beta family, nucleotide-binding domain (PF00006; HMM-score: 11.3)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- interaction partners:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.01
- Cytoplasmic Membrane Score: 9.99
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 0.67
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.007755
- TAT(Tat/SPI): 0.000184
- LIPO(Sec/SPII): 0.000586
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIELKHVTFGYNKKQMVLQDINITIPDGENVGILGESGCGKSTLASLVLGLFKPVKGEIYLSDNAVLPIFQHPLTSFNPDWTIETSLKEALYYYRGLTDNTAQDQLLLQHLSTFELNAQLLTKLPSEVSGGQLQRFNVMRSLLAQPRVLICDEITSNLDVIAEQNVINILKAQTITNLNHFIVISHDLSVLQRLVNRIIVLKDGMIVDDFAIEELFNVDRHPYTKELVQAFSY
⊟Peptides[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- sigma factors : _
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
Aurelia Hiron, Brunella Posteraro, Marie Carrière, Laetitia Remy, Cécile Delporte, Marilena La Sorda, Maurizio Sanguinetti, Vincent Juillard, Elise Borezée-Durant
A nickel ABC-transporter of Staphylococcus aureus is involved in urinary tract infection.
Mol Microbiol: 2010, 77(5);1246-60
[PubMed:20662775] [WorldCat.org] [DOI] (I p)