(reformat + add pubmed reference) |
|||
Line 1: | Line 1: | ||
__TOC__ | |||
<protect> | <protect> | ||
<aureodatabase>annotation</aureodatabase> | <aureodatabase>annotation</aureodatabase> | ||
Line 61: | Line 62: | ||
<protect> | <protect> | ||
=Protein= | =Protein= | ||
<aureodatabase>protein 3D view</aureodatabase> | <aureodatabase>protein 3D view</aureodatabase> | ||
Line 85: | Line 85: | ||
<protect> | <protect> | ||
==Structure, modifications & | ==Structure, modifications & cofactors== | ||
*<aureodatabase>protein domains</aureodatabase> | *<aureodatabase>protein domains</aureodatabase> | ||
Line 92: | Line 92: | ||
*<aureodatabase>protein effectors</aureodatabase> | *<aureodatabase>protein effectors</aureodatabase> | ||
*<aureodatabase>protein regulated operons</aureodatabase> | *<aureodatabase>protein regulated operons</aureodatabase> | ||
</protect> | </protect> | ||
Line 122: | Line 121: | ||
*<aureodatabase>protein validated peptides</aureodatabase> | *<aureodatabase>protein validated peptides</aureodatabase> | ||
*<aureodatabase>protein validated localization</aureodatabase> | |||
*<aureodatabase>protein validated quantitative data</aureodatabase> | |||
*<aureodatabase>protein partners</aureodatabase> | |||
</protect> | </protect> | ||
Line 196: | Line 198: | ||
=Other Information= | =Other Information= | ||
</protect> | </protect> | ||
The article "High-throughput transposon sequencing highlights the cell | The article "High-throughput transposon sequencing highlights the cell wall as an important barrier for osmotic stress in methicillin resistant Staphylococcus aureus and underlines a tailored response to different osmotic stressors" identified the DUF2538 domain containing gene SAUSA300_0957 (gene 957) as essential under salt stress. <ref>{{cite_pubmed|PMID=31770461}}</ref> | ||
wall as an important barrier for osmotic stress in methicillin | |||
resistant Staphylococcus aureus and underlines a tailored | |||
response to different osmotic stressors" identified the DUF2538 domain containing gene | |||
SAUSA300_0957 (gene 957) as essential under salt stress | |||
<protect> | <protect> | ||
=Literature= | =Literature= | ||
Line 210: | Line 204: | ||
<references/> | <references/> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
==Relevant publications== | ==Relevant publications== | ||
<aureodatabase>pubmed paper</aureodatabase> | <aureodatabase>pubmed paper</aureodatabase> | ||
</protect> | </protect> | ||
Latest revision as of 16:41, 5 June 2020
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_0957 [new locus tag: SAUSA300_RS05145 ]
- pan locus tag?: SAUPAN003263000
- symbol: SAUSA300_0957
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_0957 [new locus tag: SAUSA300_RS05145 ]
- symbol: SAUSA300_0957
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1048806..1049276
- length: 471
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3915010 NCBI
- RefSeq: YP_493655 NCBI
- BioCyc: see SAUSA300_RS05145
- MicrobesOnline: 1292472 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAGTAGAAAAACATACGAAAAGATTGCAAATATAAATGGCATGTTTAATATGTTAGAA
CAACAAATCATTCATAGCCAAGATATGGCTCATTTTAGAAGTGAATTTTTTTACGTCAAT
CATGAGCATCGAGAAAACTATGAAGCACTCCTAATTTATTACAAAAATAGTATCGACAAT
CCTATTGTAGATGGTGCATGTTATATTTTAGCCCTACCTGAAATTTTCAATAGTGTTGAT
GTTTTCGAATCAGAGTTACCATTTTCATGGGTATATGATGAAAATGGCATTACCGAAACA
ATGAAATCACTTAGCATTCCATTACAATATTTAGTTGCAGCAGCTTTAGAAGTAACTGAT
GTGAATATATTTAAGCCTTCAGGATTTACAATGGGAATGAATAATTGGAATATTGCTCAA
ATGCGAATCTTTTGGCAATATACAGCAATTATTAGAAAAGAAGCACTATAA60
120
180
240
300
360
420
471
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_0957 [new locus tag: SAUSA300_RS05145 ]
- symbol: SAUSA300_0957
- description: hypothetical protein
- length: 156
- theoretical pI: 4.62139
- theoretical MW: 18267.8
- GRAVY: -0.098718
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004126
- TAT(Tat/SPI): 0.000174
- LIPO(Sec/SPII): 0.000299
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSRKTYEKIANINGMFNMLEQQIIHSQDMAHFRSEFFYVNHEHRENYEALLIYYKNSIDNPIVDGACYILALPEIFNSVDVFESELPFSWVYDENGITETMKSLSIPLQYLVAAALEVTDVNIFKPSGFTMGMNNWNIAQMRIFWQYTAIIRKEAL
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
The article "High-throughput transposon sequencing highlights the cell wall as an important barrier for osmotic stress in methicillin resistant Staphylococcus aureus and underlines a tailored response to different osmotic stressors" identified the DUF2538 domain containing gene SAUSA300_0957 (gene 957) as essential under salt stress. [1]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Christopher F Schuster, David M Wiedemann, Freja C M Kirsebom, Marina Santiago, Suzanne Walker, Angelika Gründling
High-throughput transposon sequencing highlights the cell wall as an important barrier for osmotic stress in methicillin resistant Staphylococcus aureus and underlines a tailored response to different osmotic stressors.
Mol Microbiol: 2020, 113(4);699-717
[PubMed:31770461] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]
Christopher F Schuster, David M Wiedemann, Freja C M Kirsebom, Marina Santiago, Suzanne Walker, Angelika Gründling
High-throughput transposon sequencing highlights the cell wall as an important barrier for osmotic stress in methicillin resistant Staphylococcus aureus and underlines a tailored response to different osmotic stressors.
Mol Microbiol: 2020, 113(4);699-717
[PubMed:31770461] [WorldCat.org] [DOI] (I p)