Jump to navigation
Jump to search
m (Text replacement - "<protect> =Summary= * <aureodatabase>organism" to "<protect> <aureodatabase>NCBI date</aureodatabase> =Summary= * <aureodatabase>organism") |
m (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "") |
||
Line 101: | Line 101: | ||
* <aureodatabase>protein GI</aureodatabase> | * <aureodatabase>protein GI</aureodatabase> | ||
* <aureodatabase>protein UniProt</aureodatabase> | * <aureodatabase>protein UniProt</aureodatabase> | ||
* <aureodatabase>protein RefSeq</aureodatabase> | * <aureodatabase>protein RefSeq</aureodatabase> | ||
</protect> | </protect> |
Revision as of 17:37, 10 March 2016
NCBI date : _
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_0858 [new locus tag: SAUSA300_RS04630 ]
- pan locus tag?: SAUPAN003057000
- symbol: SAUSA300_0858
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_0858 [new locus tag: SAUSA300_RS04630 ]
- symbol: SAUSA300_0858
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 935714..936058
- length: 345
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3915087 NCBI
- gene Genbank : _
⊟Phenotype[edit | edit source]
- Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301GTGCGTGTAACTGGTATTCAACCATACGGTGCGTTTGTTGAGACCCCTAATCATACTGAA
GGACTGATTCATATATCAGAAATTATGGATGACTACGTTCATAATTTGAAGAAATTTCTA
TCAGAAGGCCAAATTGTTAAAGCTAAAATTTTGTCTATAGATGATGAAGGAAAGCTTAAT
CTATCATTAAAGGATAATGATTACTTCAAAAATTATGAGCGTAAGAAGGAAAAACAATCA
GTATTAGATGAAATCAGAGAAACAGAAAAATATGGGTTTCAAACACTTAAAGAACGCTTA
CCAATCTGGATAAAACAGTCAAAGCGAGCAATTCGAAACGACTAA60
120
180
240
300
345
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_0858 [new locus tag: SAUSA300_RS04630 ]
- symbol: SAUSA300_0858
- description: hypothetical protein
- length: 114
- theoretical pI: 8.81649
- theoretical MW: 13427.2
- GRAVY: -0.791228
⊟Function[edit | edit source]
- TIGRFAM: Transcription Degradation of RNA polyribonucleotide nucleotidyltransferase (TIGR03591; EC 2.7.7.8; HMM-score: 52.7)Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bS1 (TIGR00717; HMM-score: 48)and 2 moreTranscription Degradation of RNA ribonuclease R (TIGR02063; EC 3.1.-.-; HMM-score: 21.8)guanosine pentaphosphate synthetase I/polyribonucleotide nucleotidyltransferase (TIGR02696; EC 2.7.-.-,2.7.7.8; HMM-score: 20.8)
- TheSEED :
- General stress protein 13
- PFAM: OB (CL0021) S1; S1 RNA binding domain (PF00575; HMM-score: 46.5)and 2 moreno clan defined UAE_UbL; Ubiquitin/SUMO-activating enzyme ubiquitin-like domain (PF14732; HMM-score: 18.5)TRB (CL0206) BPL_C; Biotin protein ligase C terminal domain (PF02237; HMM-score: 13)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- interaction partners:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002761
- TAT(Tat/SPI): 0.00014
- LIPO(Sec/SPII): 0.000299
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRVTGIQPYGAFVETPNHTEGLIHISEIMDDYVHNLKKFLSEGQIVKAKILSIDDEGKLNLSLKDNDYFKNYERKKEKQSVLDEIRETEKYGFQTLKERLPIWIKQSKRAIRND
⊟Peptides[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- sigma factors : _
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.