From AureoWiki
Jump to navigation Jump to search
(Created page with "<protect> =Summary= * <aureodatabase>organism</aureodatabase> * <aureodatabase>locus</aureodatabase> * <aureodatabase>pan locus</aureodatabase> * <aureodatabase>gene symbol</...")
 
m (Text replacement - "<protect> =Summary= * <aureodatabase>organism" to "<protect> <aureodatabase>NCBI date</aureodatabase> =Summary= * <aureodatabase>organism")
Line 1: Line 1:
<protect>
<protect>
<aureodatabase>NCBI date</aureodatabase>
=Summary=
=Summary=



Revision as of 12:47, 12 January 2016

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0612 [new locus tag: SAUSA300_RS03285 ]
  • symbol: SAUSA300_0612
  • product: putative monovalent cation/H+ antiporter subunit C
  • replicon: chromosome
  • strand: +
  • coordinates: 684945..685289
  • length: 345
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID: 3913805 NCBI
  • gene Genbank : _

Phenotype[edit | edit source]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAATTTAATATTATTACTAGTTATAGGATTTTTAGTGTTTATAGGAACATATATGATT
    TTATCAATCAATTTAATTCGTATTGTAATCGGAATTTCAATATATACTCATGCTGGTAAT
    CTCATTATTATGAGTATGGGAACGTATGGTTCTAGTAGATCAGAACCACTAATAACTGGT
    GGAAACCAATTGTTTGTTGATCCCTTGTTACAAGCTATTGTACTAACTGCAATAGTTATA
    GGGTTTGGGATGACTGCGTTTTTACTTGTACTTGTTTATAGAACTTATAAAGTAACAAAA
    GAAGATGAAATTGAAGGCCTAAGGGGGGAAGATGATGCTAAGTAA
    60
    120
    180
    240
    300
    345

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_0612 [new locus tag: SAUSA300_RS03285 ]
  • symbol: SAUSA300_0612
  • description: putative monovalent cation/H+ antiporter subunit C
  • length: 114
  • theoretical pI: 4.93178
  • theoretical MW: 12495.9
  • GRAVY: 0.886842

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Cations and iron carrying compounds multicomponent Na+:H+ antiporter, MnhC subunit (TIGR00941; HMM-score: 99.1)
  • TheSEED  :
    • Na(+) H(+) antiporter subunit C (TC 2.A.63.1.3)
    Membrane Transport Uni- Sym- and Antiporters Sodium Hydrogen Antiporter  Na(+) H(+) antiporter subunit C (TC 2.A.63.1.3)
  • PFAM:
    no clan defined Oxidored_q2; NADH-ubiquinone/plastoquinone oxidoreductase chain 4L (PF00420; HMM-score: 95)
    and 2 more
    Ost4; Oligosaccaryltransferase (PF10215; HMM-score: 16.2)
    DUF2070; Predicted membrane protein (DUF2070) (PF09843; HMM-score: 9)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • interaction partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.040897
    • TAT(Tat/SPI): 0.000516
    • LIPO(Sec/SPII): 0.004452
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit | edit source]

  • GI: 87161834 NCBI
  • UniProt: Q2FJ13 UniProt
  • protein Genbank : _
  • RefSeq: YP_493315 NCBI

Protein sequence[edit | edit source]

  • MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGTYGSSRSEPLITGGNQLFVDPLLQAIVLTAIVIGFGMTAFLLVLVYRTYKVTKEDEIEGLRGEDDAK

Peptides[edit | edit source]

  • experimentally validated: data available for NCTC8325

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]