From AureoWiki
Revision as of 11:20, 11 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0577 [new locus tag: SAUSA300_RS03085 ]
  • pan locus tag?: SAUPAN002438000
  • symbol: SAUSA300_0577
  • pan gene symbol?: hypR
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0577 [new locus tag: SAUSA300_RS03085 ]
  • symbol: SAUSA300_0577
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 651567..651983
  • length: 417
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    GTGCATGTATTAGCTTTTTTAACTAAGCATCATTCAGAAAAATTCAATAGTAGTTCATTA
    GCAGAATTAACTTGTTTAAATCCTGTTCAATTACGACGCGTGACGACTCAACTTGTCGAT
    TTAAAAATGATTGACACAATACGAGGTAAAGATGGCGGTTATTTAGCAAATGATCAAAGT
    GCTGATGTCTCTCTAGCAACATTATATAAACATTTTGTCTTAGAGAAAGAACACCACACA
    CGTCTATTTACTGGCGACGAAGGCAGTCACTGTCAAATTGCTCGTAATATTGCAACTACC
    ATGTCACATTATCAGCAAGACGAACAGAATATCATTATTAATTTTTATAATGGAAAAACA
    ATCAAAGATGTCATTGAAGACATTCAAAAGGAGGATTTATGTCATGAAAACATATGA
    60
    120
    180
    240
    300
    360
    417

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_0577 [new locus tag: SAUSA300_RS03085 ]
  • symbol: SAUSA300_0577
  • description: hypothetical protein
  • length: 138
  • theoretical pI: 6.41167
  • theoretical MW: 15797.8
  • GRAVY: -0.436957

Function[edit | edit source]

  • TIGRFAM:
    Unknown function General Rrf2 family protein (TIGR00738; HMM-score: 33.7)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly SUF system regulator (TIGR02944; HMM-score: 30.6)
    Signal transduction Regulatory functions DNA interactions FeS assembly SUF system regulator (TIGR02944; HMM-score: 30.6)
    and 2 more
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other iron-sulfur cluster assembly transcription factor IscR (TIGR02010; HMM-score: 20.7)
    Signal transduction Regulatory functions DNA interactions iron-sulfur cluster assembly transcription factor IscR (TIGR02010; HMM-score: 20.7)
  • TheSEED  :
    • hypothetical fig|282458.1.peg.572 homolog
  • PFAM:
    HTH (CL0123) Rrf2; Transcriptional regulator (PF02082; HMM-score: 46.7)
    and 3 more
    Put_DNA-bind_N; Putative DNA-binding protein N-terminus (PF06971; HMM-score: 14.6)
    TFIIE_alpha; TFIIE alpha subunit (PF02002; HMM-score: 14)
    HrcA_DNA-bdg; Winged helix-turn-helix transcription repressor, HrcA DNA-binding (PF03444; HMM-score: 13.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005182
    • TAT(Tat/SPI): 0.000542
    • LIPO(Sec/SPII): 0.001482
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MHVLAFLTKHHSEKFNSSSLAELTCLNPVQLRRVTTQLVDLKMIDTIRGKDGGYLANDQSADVSLATLYKHFVLEKEHHTRLFTGDEGSHCQIARNIATTMSHYQQDEQNIIINFYNGKTIKDVIEDIQKEDLCHENI

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]