From AureoWiki
Revision as of 01:19, 11 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "gene Genbank" to "gene RefSeq")
Jump to navigation Jump to search

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0530 [new locus tag: SAUSA300_RS02835 ]
  • symbol: rpsL
  • product: 30S ribosomal protein S12
  • replicon: chromosome
  • strand: +
  • coordinates: 593354..593767
  • length: 414
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID: 3914280 NCBI
  • RefSeq: YP_493233 NCBI

Phenotype[edit | edit source]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGCCAACTATTAACCAATTAGTACGTAAACCAAGACAAAGCAAAATCAAAAAATCAGAT
    TCTCCAGCTTTAAATAAAGGTTTCAACAGTAAAAAGAAAAAATTTACTGACTTAAACTCA
    CCACAAAAACGTGGTGTATGTACTCGTGTAGGTACAATGACACCTAAAAAACCTAACTCA
    GCGTTACGTAAATATGCACGTGTGCGTTTATCAAACAACATCGAAATTAACGCATACATC
    CCTGGTATCGGACATAACTTACAAGAACACAGTGTTGTACTTGTACGTGGTGGACGTGTA
    AAAGACTTACCAGGTGTGCGTTACCATATTGTACGTGGAGCACTTGATACTTCAGGTGTT
    GACGGACGTAGACAAGGTCGTTCATTATACGGAACTAAGAAACCTAAAAACTAA
    60
    120
    180
    240
    300
    360
    414

Protein[edit | edit source]

Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5TCU

General[edit | edit source]

  • locus tag: SAUSA300_0530 [new locus tag: SAUSA300_RS02835 ]
  • symbol: RpsL
  • description: 30S ribosomal protein S12
  • length: 137
  • theoretical pI: 11.8375
  • theoretical MW: 15286.7
  • GRAVY: -0.854015

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS12 (TIGR00981; HMM-score: 221.2)
    and 2 more
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS12 (TIGR00982; HMM-score: 39.4)
    Genetic information processing Protein synthesis Translation factors translation initiation factor IF-1 (TIGR00008; HMM-score: 13.4)
  • TheSEED  :
    • SSU ribosomal protein S12p (S23e)
    Protein Metabolism Protein biosynthesis Ribosome SSU bacterial  SSU ribosomal protein S12p (S23e)
    and 2 more
    Protein Metabolism Protein processing and modification Ribosomal protein S12p Asp methylthiotransferase  SSU ribosomal protein S12p (S23e)
    Virulence Virulence - no subcategory Mycobacterium virulence operon involved in protein synthesis (SSU ribosomal proteins)  SSU ribosomal protein S12p (S23e)
  • PFAM:
    OB (CL0021) Ribosom_S12_S23; Ribosomal protein S12/S23 (PF00164; HMM-score: 123.4)

Structure, modifications & interactions[edit | edit source]

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.029192
    • TAT(Tat/SPI): 0.011807
    • LIPO(Sec/SPII): 0.005124
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 87162023 NCBI
  • UniProt: Q2FJ95 UniProt
  • protein Genbank : _
  • RefSeq: YP_493233 NCBI

Protein sequence[edit | edit source]

  • MPTINQLVRKPRQSKIKKSDSPALNKGFNSKKKKFTDLNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPKN

Peptides[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • sigma factors : _
  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 1.48 1.49 1.50 1.51 1.52 1.53 1.54 1.55 1.56 1.57 1.58 1.59 1.60 1.61 1.62 1.63 1.64 1.65 1.66 1.67 1.68 1.69 1.70 1.71 1.72 1.73 1.74 1.75 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]