From AureoWiki
Jump to navigation Jump to search
m (Text replacement - "<protect> =Summary= * <aureodatabase>organism" to "<protect> <aureodatabase>NCBI date</aureodatabase> =Summary= * <aureodatabase>organism")
m (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "")
Line 101: Line 101:
* <aureodatabase>protein GI</aureodatabase>
* <aureodatabase>protein GI</aureodatabase>
* <aureodatabase>protein UniProt</aureodatabase>
* <aureodatabase>protein UniProt</aureodatabase>
* <aureodatabase>protein Genbank</aureodatabase>
* <aureodatabase>protein RefSeq</aureodatabase>
* <aureodatabase>protein RefSeq</aureodatabase>
</protect>
</protect>

Revision as of 10:12, 11 March 2016

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0233 [new locus tag: SAUSA300_RS01235 ]
  • symbol: SAUSA300_0233
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 281010..281183
  • length: 174
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID: 3913488 NCBI
  • gene Genbank : _

Phenotype[edit | edit source]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGAAACTTAATCAACGTTACGTAAAAGTATTTGCATTATATTTCGTAAGTATTGTTACT
    GCAAATATTATTGTTAAAAATAATAATTTAATTAAAACATTGATACAAACCATAGCCGGG
    TACACGGTCTTTGCAGTTGGTTTGAAGTATTTAACTAAACGTAAAAATAAATGA
    60
    120
    174

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_0233 [new locus tag: SAUSA300_RS01235 ]
  • symbol: SAUSA300_0233
  • description: hypothetical protein
  • length: 57
  • theoretical pI: 11.0923
  • theoretical MW: 6564.9
  • GRAVY: 0.319298

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG01108527: hypothetical protein
  • PFAM:
    no clan defined DUF5325; Family of unknown function (DUF5325) (PF17259; HMM-score: 13.2)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • interaction partners:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: 2
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.143631
    • TAT(Tat/SPI): 0.00063
    • LIPO(Sec/SPII): 0.078405
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKLNQRYVKVFALYFVSIVTANIIVKNNNLIKTLIQTIAGYTVFAVGLKYLTKRKNK

Peptides[edit | edit source]

  • experimentally validated: data available for NCTC8325

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • sigma factors : _
  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]