From AureoWiki
Revision as of 17:31, 19 June 2014 by Robot (talk | contribs) (Created page with "<protect> =Summary= * <aureodatabase>organism</aureodatabase> * <aureodatabase>locus</aureodatabase> * <aureodatabase>pan locus</aureodatabase> * <aureodatabase>gene symbol</...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAS085 [new locus tag: SA_RS12135 ]
  • symbol: SAS085
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2374038..2374229
  • length: 192
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Gene ID: 1125037 NCBI
  • gene Genbank : _

Phenotype[edit | edit source]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGATGGGTTACATTATATTGTTTTTTCTAGCTGGTCCAGTAATTTTAGGCGTTGGAAAT
    TTGGTGATTGGTCCTATATTTAACAAACAGACACCATTTCGCGTGCAAGTAAGATCTTTT
    GTTGTTGGTTCAATGATTTACTTAATACTCGCAACAATTGGCTATTTTTTACTATTACAA
    GGTAAACTTTAA
    60
    120
    180
    192

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAS085 [new locus tag: SA_RS12135 ]
  • symbol: SAS085
  • description: hypothetical protein
  • length: 63
  • theoretical pI: 10.5722
  • theoretical MW: 6962.54
  • GRAVY: 1.2746

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Hypothetical protein SAV2319
  • PFAM:

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • interaction partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.010588
    • TAT(Tat/SPI): 0.000193
    • LIPO(Sec/SPII): 0.096083
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit | edit source]

  • GI: 15927899 NCBI
  • UniProt: A0A0H3JRF5 UniProt
  • protein Genbank : _
  • RefSeq: NP_375432 NCBI

Protein sequence[edit | edit source]

  • MMGYIILFFLAGPVILGVGNLVIGPIFNKQTPFRVQVRSFVVGSMIYLILATIGYFLLLQGKL

Peptides[edit | edit source]

  • experimentally validated:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • sigma factors : _
  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]