NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SAS018 [new locus tag: SA_RS04270 ]
- pan locus tag?: SAUPAN002806000
- symbol: SAS018
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAS018 [new locus tag: SA_RS04270 ]
- symbol: SAS018
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 858892..859080
- length: 189
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1123560 NCBI
- RefSeq: NP_374006 NCBI
- BioCyc: see SA_RS04270
- MicrobesOnline: 103032 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGTCTTTACATTTTGCAATTCTGTTTTGGCTAGCATTAATTTTCTTAGTTGCCGCTACG
TTTATACTCGTATTAATGAAAAAAACTGGCAAAGAATCTAAAAAAGAGTCCTATTTAAGT
TTCACTGTCATTCTCTATATTTTTGGATTCGCTATATTAATATACACATTTATATTTGGT
GTGCTATAA60
120
180
189
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAS018 [new locus tag: SA_RS04270 ]
- symbol: SAS018
- description: hypothetical protein
- length: 62
- theoretical pI: 10.0084
- theoretical MW: 7142.76
- GRAVY: 1.46613
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- FIG01107975: hypothetical protein
- PFAM: no clan defined BRI3BP; Negative regulator of p53/TP53 (PF14965; HMM-score: 16.7)MRAP; Melanocortin-2 receptor accessory protein family (PF15183; HMM-score: 16.2)GPCR_A (CL0192) Bac_rhodopsin; Bacteriorhodopsin-like protein (PF01036; HMM-score: 15)and 14 moreno clan defined DUF3611; Protein of unknown function (DUF3611) (PF12263; HMM-score: 12.8)PGG; Domain of unknown function (PF13962; HMM-score: 12.4)Glucos_trans_II; Glucosyl transferase GtrII (PF14264; HMM-score: 11.5)SLC3A2_N; Solute carrier family 3 member 2 N-terminus (PF16028; HMM-score: 11.5)DUF3742; Protein of unknown function (DUF3742) (PF12553; HMM-score: 11.4)SIT; SHP2-interacting transmembrane adaptor protein, SIT (PF15330; HMM-score: 11.2)DUF3671; Protein of unknown function (PF12420; HMM-score: 10.3)DUF4051; Protein of unknown function (DUF4051) (PF13260; HMM-score: 9.9)NfeD-like (CL0252) NfeD; NfeD-like C-terminal, partner-binding (PF01957; HMM-score: 9.5)no clan defined CcmH; Cytochrome C biogenesis protein (PF03918; HMM-score: 9.2)Tetraspannin (CL0347) Tetraspannin; Tetraspanin family (PF00335; HMM-score: 9)no clan defined DUF2208; Predicted membrane protein (DUF2208) (PF09973; HMM-score: 8.4)DHHC; DHHC palmitoyltransferase (PF01529; HMM-score: 8.3)Peptidase_MA (CL0126) DUF3810; Protein of unknown function (DUF3810) (PF12725; HMM-score: 8.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.008667
- TAT(Tat/SPI): 0.00071
- LIPO(Sec/SPII): 0.122172
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.