From AureoWiki
Revision as of 13:51, 12 January 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "<protect> =Summary= * <aureodatabase>organism" to "<protect> <aureodatabase>NCBI date</aureodatabase> =Summary= * <aureodatabase>organism")
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAS006
  • symbol: SAS006
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 232459..232635
  • length: 177
  • essential: no DEG

Accession numbers[edit | edit source]

  • Gene ID: 1122974 NCBI
  • gene Genbank : _

Phenotype[edit | edit source]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGAAGAAAAATGATTTGTTAGTAATGAGTGTAGTATATATTTTAACTTCAGTCATAATG
    TTCTACATTAATGGATTAAGTAAACAATTTTTTACATATGTAGTTGGTTTCCCAATTATT
    TATTTTGGTTATATATGTCTAGTTAATCTTATAAAAAAAAGAAGCCGGAATAATTAA
    60
    120
    177

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAS006
  • symbol: SAS006
  • description: hypothetical protein
  • length: 58
  • theoretical pI: 10.2503
  • theoretical MW: 6817.24
  • GRAVY: 0.672414

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG01108084: hypothetical protein
  • PFAM:
    no clan defined DUF308; Short repeat of unknown function (DUF308) (PF03729; HMM-score: 18.2)
    and 2 more
    Oxa1 (CL0376) DUF106; Integral membrane protein DUF106 (PF01956; HMM-score: 14.4)
    no clan defined MNSV_P7B; Melon necrotic spot virus P7B protein (PF06692; HMM-score: 12.6)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • interaction partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.024299
    • TAT(Tat/SPI): 0.000434
    • LIPO(Sec/SPII): 0.064102
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit | edit source]

  • GI: 15925908 NCBI
  • UniProt: A0A0H3JSL3 UniProt
  • protein Genbank : _
  • RefSeq: NP_373441 NCBI

Protein sequence[edit | edit source]

  • MKKNDLLVMSVVYILTSVIMFYINGLSKQFFTYVVGFPIIYFGYICLVNLIKKRSRNN

Peptides[edit | edit source]

  • experimentally validated:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • sigma factors : _
  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]