From AureoWiki
Revision as of 11:46, 10 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "gene Genbank" to "gene RefSeq")
Jump to navigation Jump to search

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_02785
  • symbol: SAOUHSC_02785
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2558305..2558631
  • length: 327
  • essential: no [1] DEG other strains

Accession numbers[edit | edit source]

  • Gene ID: 3921440 NCBI
  • RefSeq: YP_501245 NCBI

Phenotype[edit | edit source]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGTTTACTACGTATAAAAATATTAATGAACTTGAAAATGCCTATGATGAAGAAAGAAAA
    CAATTGAATGATGCATTCAATCAAATTGATGAATTAAGACATCAAACACGCAAGAAATGT
    GAACAAATGTATGATCATTTCTTATATCTCAAACATAAAATGAATTATAGTGAAGACGCT
    ATGATCAGGATGACACGTATTATAGAATCTTTCGATAGAGAAACGAATCAACGTATCCGA
    CATCACGAAATGAAATTAGAAGATTATAAAGATGAGTTAAGAAGAGAATATCTAAAACAA
    TCTGACAGAATTGAAGGAGATGAATAA
    60
    120
    180
    240
    300
    327

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_02785
  • symbol: SAOUHSC_02785
  • description: hypothetical protein
  • length: 108
  • theoretical pI: 5.63959
  • theoretical MW: 13586.1
  • GRAVY: -1.45

Function[edit | edit source]

  • TIGRFAM:
    two transmembrane protein (TIGR04527; HMM-score: 9.7)
    and 3 more
    Genetic information processing DNA metabolism Degradation of DNA exodeoxyribonuclease VII, large subunit (TIGR00237; EC 3.1.11.6; HMM-score: 7.2)
    Genetic information processing Protein fate Protein folding and stabilization chaperone protein DnaK (TIGR02350; HMM-score: 6.9)
    variant surface antigen, rifin family (TIGR01477; HMM-score: 5.3)
  • TheSEED  :
    • FIG01107979: hypothetical protein
  • PFAM:
    VPS23_C (CL0596) Mod_r; Modifier of rudimentary (Mod(r)) protein (PF07200; HMM-score: 15.7)
    no clan defined Jnk-SapK_ap_N; JNK_SAPK-associated protein-1 (PF09744; HMM-score: 15.4)
    AATF-Che1; Apoptosis antagonizing transcription factor (PF13339; HMM-score: 13.6)
    Exonuc_VII_L; Exonuclease VII, large subunit (PF02601; HMM-score: 12.8)
    and 9 more
    HUP (CL0039) CDPS; Cyclodipeptide synthase (PF16715; HMM-score: 11.9)
    no clan defined DUF1043; Protein of unknown function (DUF1043) (PF06295; HMM-score: 11.6)
    SWIRM-assoc_1; SWIRM-associated region 1 (PF16495; HMM-score: 11.6)
    Fib_alpha; Fibrinogen alpha/beta chain family (PF08702; HMM-score: 10.8)
    Spc24; Spc24 subunit of Ndc80 (PF08286; HMM-score: 10.7)
    DUF4407; Domain of unknown function (DUF4407) (PF14362; HMM-score: 10.2)
    V_ATPase_I; V-type ATPase 116kDa subunit family (PF01496; HMM-score: 7.7)
    FliD_C; Flagellar hook-associated protein 2 C-terminus (PF07195; HMM-score: 7.4)
    FapA; Flagellar Assembly Protein A (PF03961; HMM-score: 6.5)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • interaction partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004856
    • TAT(Tat/SPI): 0.000517
    • LIPO(Sec/SPII): 0.001212
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 88196421 NCBI
  • UniProt: Q2FVC8 UniProt
  • protein Genbank : _
  • RefSeq: YP_501245 NCBI

Protein sequence[edit | edit source]

  • MFTTYKNINELENAYDEERKQLNDAFNQIDELRHQTRKKCEQMYDHFLYLKHKMNYSEDAMIRMTRIIESFDRETNQRIRHHEMKLEDYKDELRREYLKQSDRIEGDE

Peptides[edit | edit source]

  • experimentally validated:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • sigma factors : _
  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
    Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
    BMC Genomics: 2009, 10;291
    [PubMed:19570206] [WorldCat.org] [DOI] (I e)
  2. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]