From AureoWiki
Revision as of 07:23, 11 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "gene Genbank" to "gene RefSeq")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_02303
  • pan locus tag?: SAUPAN005339000
  • symbol: SAOUHSC_02303
  • pan gene symbol?: mazF
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_02303
  • symbol: SAOUHSC_02303
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2134939..2135301
  • length: 363
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGATTAGACGAGGAGATGTTTATTTAGCAGATTTATCACCAGTACAGGGATCTGAACAA
    GGGGGAGTCAGACCTGTAGTCATAATTCAAAATGATACTGGTAATAAATATAGTCCTACA
    GTTATTGTTGCGGCAATAACTGGTAGGATTAATAAAGCGAAAATACCGACACATGTAGAG
    ATTGAAAAGAAAAAGTATAAGTTGGATAAAGACTCAGTTATATTATTAGAACAAATTCGT
    ACACTTGATAAAAAACGATTGAAAGAAAAACTGACGTACTTATCCGATGATAAAATGAAA
    GAAGTAGATAATGCACTAATGATTAGTTTAGGGCTGAATGCAGTAGCTCACCAGAAAAAT
    TAG
    60
    120
    180
    240
    300
    360
    363

Protein[edit | edit source]

Protein Data Bank: 2MF2
Protein Data Bank: 4MZM
Protein Data Bank: 4MZP
Protein Data Bank: 4MZT
Protein Data Bank: 5DLO

General[edit | edit source]

  • locus tag: SAOUHSC_02303
  • symbol: SAOUHSC_02303
  • description: hypothetical protein
  • length: 120
  • theoretical pI: 10.1686
  • theoretical MW: 13441.6
  • GRAVY: -0.389167

Function[edit | edit source]

  • reaction:
    EC 3.1.-.-?  ExPASy
  • TIGRFAM:
    Unknown function Enzymes of unknown specificity B12-binding domain/radical SAM domain protein, MJ_1487 family (TIGR04013; HMM-score: 11.1)
  • TheSEED  :
    • mRNA interferase, programmed cell death toxin MazF
    Regulation and Cell signaling Programmed Cell Death and Toxin-antitoxin Systems MazEF toxin-antitoxing (programmed cell death) system  Programmed cell death toxin YdcE
    and 1 more
    Regulation and Cell signaling Programmed Cell Death and Toxin-antitoxin Systems Phd-Doc, YdcE-YdcD toxin-antitoxin (programmed cell death) systems  Programmed cell death toxin YdcE
  • PFAM:
    CcdB_PemK (CL0624) PemK_toxin; PemK-like, MazF-like toxin of type II toxin-antitoxin system (PF02452; HMM-score: 115.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009401
    • TAT(Tat/SPI): 0.00089
    • LIPO(Sec/SPII): 0.001725
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [1] [2]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. 3.0 3.1 3.2 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]

Kullik, Giachino
The alternative sigma factor sigmaB in Staphylococcus aureus: regulation of the sigB operon in response to growth phase and heat shock
Arch Microbiol: 1997, 167(2-3);151-9
[PubMed:9042755] [WorldCat.org] [DOI] (I p)