From AureoWiki
Revision as of 20:23, 10 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "")
Jump to navigation Jump to search

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_01718
  • symbol: SAOUHSC_01718
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1623258..1623896
  • length: 639
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Gene ID: 3921107 NCBI
  • gene Genbank : _

Phenotype[edit | edit source]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGGATGACCTAAATAAAAAATATTTAATAGATTTACATCAACATCAAAATAGTTCAATC
    GAAGTTTTGCGTGAATTTGCCGAGGTAAATGAAGTGCCAATTGTAGATCGTTTAACATTA
    GATTTAATTAAGCAATTAATTCGTATGAATAATGTTAAAAATATTTTAGAAATTGGTACA
    GCAATCGGCTATAGTTCTATGCAATTCGCTTCTATATCTGATGACATTCATGTCACAACG
    ATAGAGCGTAATGAAACGATGATTCAATATGCTAAACAAAATTTAGCTACTTATCATTTT
    GAAAACCAGGTTCGAATTATTGAAGGTAATGCTTTAGAGCAATTTGAAAATGTAAATGAC
    AAAGTTTATGATATGATATTTATTGATGCAGCAAAAGCGCAATCAAAGAAATTTTTTGAA
    ATATATACACCACTTTTAAAGCACCAAGGTCTCGTAATTACAGATAATGTTTTATATCAC
    GGTTTTGTATCGGATATTGGGATTGTTAGATCGAGAAATGTAAGACAAATGGTTAAAAAG
    GTTCAAGATTATAATGAGTGGTTAATAAAGCAACCAGGATATACAACGAATTTTTTAAAT
    ATAGACGATGGATTAGCGATTTCAATTAAAGGAGAATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    639

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_01718
  • symbol: SAOUHSC_01718
  • description: hypothetical protein
  • length: 212
  • theoretical pI: 5.31765
  • theoretical MW: 24526.8
  • GRAVY: -0.255189

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit (TIGR02469; EC 2.1.1.132; HMM-score: 40.9)
    Genetic information processing Protein fate Protein modification and repair protein-L-isoaspartate O-methyltransferase (TIGR00080; EC 2.1.1.77; HMM-score: 33.3)
    and 13 more
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific (TIGR03533; EC 2.1.1.-; HMM-score: 31.2)
    Genetic information processing Protein fate Protein modification and repair protein-(glutamine-N5) methyltransferase, release factor-specific (TIGR03534; EC 2.1.1.-; HMM-score: 27.3)
    Genetic information processing Protein synthesis tRNA and rRNA base modification 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG (TIGR00138; EC 2.1.1.170; HMM-score: 25.1)
    Genetic information processing Protein fate Protein modification and repair methyltransferase, HemK family (TIGR00536; HMM-score: 24.9)
    methyltransferase, ATP-grasp peptide maturase system (TIGR04188; HMM-score: 23.1)
    Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA (guanine-N(7)-)-methyltransferase (TIGR00091; EC 2.1.1.33; HMM-score: 22.6)
    Genetic information processing Protein synthesis tRNA and rRNA base modification ribosomal RNA small subunit methyltransferase A (TIGR00755; EC 2.1.1.182; HMM-score: 21.7)
    Genetic information processing Protein synthesis tRNA and rRNA base modification 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD (TIGR00095; EC 2.1.1.171; HMM-score: 18)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Biotin malonyl-acyl carrier protein O-methyltransferase BioC (TIGR02072; EC 2.1.1.-; HMM-score: 17.7)
    methyltransferase, FxLD system (TIGR04364; HMM-score: 17.3)
    Unknown function Enzymes of unknown specificity tRNA (cmo5U34)-methyltransferase (TIGR00740; EC 2.1.1.-; HMM-score: 15.9)
    pseudaminic acid biosynthesis-associated methylase (TIGR03587; HMM-score: 15.5)
    methyltransferase, FkbM family (TIGR01444; HMM-score: 13.3)
  • TheSEED  :
    • FIG011945: O-methyltransferase family protein
  • PFAM:
    NADP_Rossmann (CL0063) Methyltransf_3; O-methyltransferase (PF01596; HMM-score: 91.9)
    and 17 more
    Methyltransf_24; Methyltransferase domain (PF13578; HMM-score: 47.3)
    Methyltransf_31; Methyltransferase domain (PF13847; HMM-score: 46.9)
    PCMT; Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) (PF01135; HMM-score: 35.9)
    Methyltransf_25; Methyltransferase domain (PF13649; HMM-score: 28.9)
    MTS; Methyltransferase small domain (PF05175; HMM-score: 27.6)
    GidB; rRNA small subunit methyltransferase G (PF02527; HMM-score: 26.4)
    Cons_hypoth95; Conserved hypothetical protein 95 (PF03602; HMM-score: 26.2)
    Methyltransf_4; Putative methyltransferase (PF02390; HMM-score: 25.9)
    Methyltransf_18; Methyltransferase domain (PF12847; HMM-score: 24)
    Methyltransf_12; Methyltransferase domain (PF08242; HMM-score: 23.2)
    Methyltransf_11; Methyltransferase domain (PF08241; HMM-score: 22.8)
    CMAS; Mycolic acid cyclopropane synthetase (PF02353; HMM-score: 21.7)
    Methyltransf_15; RNA cap guanine-N2 methyltransferase (PF09445; HMM-score: 20.9)
    Pyr_redox; Pyridine nucleotide-disulphide oxidoreductase (PF00070; HMM-score: 17.5)
    Met_10; Met-10+ like-protein (PF02475; HMM-score: 16.8)
    RrnaAD; Ribosomal RNA adenine dimethylase (PF00398; HMM-score: 16.5)
    Methyltransf_23; Methyltransferase domain (PF13489; HMM-score: 12.9)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • interaction partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004664
    • TAT(Tat/SPI): 0.000192
    • LIPO(Sec/SPII): 0.000152
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MDDLNKKYLIDLHQHQNSSIEVLREFAEVNEVPIVDRLTLDLIKQLIRMNNVKNILEIGTAIGYSSMQFASISDDIHVTTIERNETMIQYAKQNLATYHFENQVRIIEGNALEQFENVNDKVYDMIFIDAAKAQSKKFFEIYTPLLKHQGLVITDNVLYHGFVSDIGIVRSRNVRQMVKKVQDYNEWLIKQPGYTTNFLNIDDGLAISIKGE

Peptides[edit | edit source]

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • sigma factors : _
  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. 3.0 3.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]