NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_01715
- pan locus tag?: SAUPAN004207000
- symbol: SAOUHSC_01715
- pan gene symbol?: udk
- synonym:
- product: uridine kinase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_01715
- symbol: SAOUHSC_01715
- product: uridine kinase
- replicon: chromosome
- strand: -
- coordinates: 1620429..1621052
- length: 624
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3921104 NCBI
- RefSeq: YP_500224 NCBI
- BioCyc: G1I0R-1594 BioCyc
- MicrobesOnline: 1290138 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601ATGAAAGCTACTACAATCATTGGCATAGCTGGTGGATCTGGCTCAGGAAAAACAACTGTA
ACTAACGAAATTATGAAAAACTTAGAAGGTCATAGTGTCGCTTTACTTGCTCAAGATTAC
TATTATAAAGATCAAAAGCACTTGACTTTCGACGAGCGCCTAGAAACCAATTATGACCAT
CCATTTGCATTCGATAATGATTTATTAATTGAAAATCTTAAAGACTTGAAAAATGGTAAA
GCAGTAGAAGTACCGACATATGATTATGCTAGTCATACAAGAAGTGACATTACCATTGAT
TTTAAACCTAAAGATGTTATTATCGTAGAAGGCATTTTCGCTTTAGAAAATAAGGTATTA
CGTGATATGATGGATGTTAAAATATATGTTGATACAGATGCAGACTTGAGAATATTACGC
CGTTTAACACGAGATACTAAAGAGCGTGGGCGTTCAATGGACTCTGTTATCAATCAATAT
TTAAGTGTTGTTAGACCTATGCATGACCAATTTATTGAACCGACTAAGAAATATGCTGAT
ATAATTATTCCTGAAGGTGGGAGCAATAAAGTTGCAATAGATATTATGACAACAAAAATT
CAGTCTTTAGTTAGCAAGCAATAG60
120
180
240
300
360
420
480
540
600
624
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_01715
- symbol: SAOUHSC_01715
- description: uridine kinase
- length: 207
- theoretical pI: 6.03587
- theoretical MW: 23504.7
- GRAVY: -0.395652
⊟Function[edit | edit source]
- reaction: EC 2.7.1.48? ExPASyUridine kinase ATP + uridine = ADP + UMP ATP + cytidine = ADP + CMP?
- TIGRFAM: Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides uridine kinase (TIGR00235; EC 2.7.1.48; HMM-score: 294.6)and 23 moreBiosynthesis of cofactors, prosthetic groups, and carriers Pantothenate and coenzyme A pantothenate kinase (TIGR00554; EC 2.7.1.33; HMM-score: 36.2)putative cytidylate kinase (TIGR02173; EC 2.7.4.14; HMM-score: 26.1)Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions cytidylate kinase (TIGR00017; EC 2.7.4.14; HMM-score: 20.6)Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin molybdopterin-guanine dinucleotide biosynthesis protein B (TIGR00176; HMM-score: 19.9)Biosynthesis of cofactors, prosthetic groups, and carriers Pantothenate and coenzyme A dephospho-CoA kinase (TIGR00152; EC 2.7.1.24; HMM-score: 18.9)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 18.5)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 18.5)Central intermediary metabolism Nitrogen metabolism urease accessory protein UreG (TIGR00101; HMM-score: 17.3)Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions dTMP kinase (TIGR00041; EC 2.7.4.9; HMM-score: 16.3)Central intermediary metabolism Sulfur metabolism adenylyl-sulfate kinase (TIGR00455; EC 2.7.1.25; HMM-score: 15.5)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 14.6)P-type DNA transfer ATPase VirB11 (TIGR02788; HMM-score: 14.5)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides cellulose synthase operon protein YhjQ (TIGR03371; HMM-score: 13.7)Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin cobalamin biosynthesis protein CobW (TIGR02475; HMM-score: 13.2)DNA metabolism DNA replication, recombination, and repair orc1/cdc6 family replication initiation protein (TIGR02928; HMM-score: 12.9)Transport and binding proteins Amino acids, peptides and amines LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 12.5)Regulatory functions Protein interactions LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 12.5)Cellular processes Conjugation P-type conjugative transfer ATPase TrbB (TIGR02782; HMM-score: 12.3)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 11.1)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 10.8)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 10.5)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 10)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 8.7)
- TheSEED :
- Uridine kinase (EC 2.7.1.48)
- PFAM: P-loop_NTPase (CL0023) PRK; Phosphoribulokinase / Uridine kinase family (PF00485; HMM-score: 157.6)and 25 moreAAA_18; AAA domain (PF13238; HMM-score: 39.7)dNK; Deoxynucleoside kinase (PF01712; HMM-score: 23)AAA_17; AAA domain (PF13207; HMM-score: 22.5)cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 21.2)Cytidylate_kin; Cytidylate kinase (PF02224; HMM-score: 20.7)CoaE; Dephospho-CoA kinase (PF01121; HMM-score: 20.6)ABC_tran; ABC transporter (PF00005; HMM-score: 19.5)AAA_33; AAA domain (PF13671; HMM-score: 18.9)MobB; Molybdopterin guanine dinucleotide synthesis protein B (PF03205; HMM-score: 17.7)RNA_helicase; RNA helicase (PF00910; HMM-score: 17.4)AAA_16; AAA ATPase domain (PF13191; HMM-score: 17.1)AAA_26; AAA domain (PF13500; HMM-score: 16.9)AAA_28; AAA domain (PF13521; HMM-score: 16.2)Zeta_toxin; Zeta toxin (PF06414; HMM-score: 16)AAA_19; AAA domain (PF13245; HMM-score: 16)NTPase_1; NTPase (PF03266; HMM-score: 15.1)CbiA; CobQ/CobB/MinD/ParA nucleotide binding domain (PF01656; HMM-score: 14.5)ArgK; ArgK protein (PF03308; HMM-score: 14.5)Thymidylate_kin; Thymidylate kinase (PF02223; HMM-score: 14.4)T2SSE; Type II/IV secretion system protein (PF00437; HMM-score: 14.3)APS_kinase; Adenylylsulphate kinase (PF01583; HMM-score: 14.1)AAA_30; AAA domain (PF13604; HMM-score: 13.7)AAA_22; AAA domain (PF13401; HMM-score: 13.3)NB-ARC; NB-ARC domain (PF00931; HMM-score: 12.5)TrwB_AAD_bind; Type IV secretion-system coupling protein DNA-binding domain (PF10412; HMM-score: 12)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.044006
- TAT(Tat/SPI): 0.0012
- LIPO(Sec/SPII): 0.033459
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKATTIIGIAGGSGSGKTTVTNEIMKNLEGHSVALLAQDYYYKDQKHLTFDERLETNYDHPFAFDNDLLIENLKDLKNGKAVEVPTYDYASHTRSDITIDFKPKDVIIVEGIFALENKVLRDMMDVKIYVDTDADLRILRRLTRDTKERGRSMDSVINQYLSVVRPMHDQFIEPTKKYADIIIPEGGSNKVAIDIMTTKIQSLVSKQ
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas [1] [2]
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: greA < SAOUHSC_01715 < SAOUHSC_01716 < SAOUHSC_01717 < SAOUHSC_01718predicted SigA promoter [3] : greA < SAOUHSC_01715 < SAOUHSC_01716 < SAOUHSC_01717 < SAOUHSC_01718 < S676
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [3] Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑ 3.0 3.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)