⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_01285
- pan locus tag?: SAUPAN003625000
- symbol: SAOUHSC_01285
- pan gene symbol?: glnR
- synonym:
- product: glutamine synthetase repressor
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
⊟Accession numbers[edit | edit source]
- Gene ID: 3920172 NCBI
- gene Genbank : _
⊟Phenotype[edit | edit source]
- Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGATATCGAATGATGCAATCAGACGAAATATGGCTGTCTTCTCTATGAGTGTAGTAAGT
AAGTTAACGGATTTAACGCCAAGGCAAATACGTTACTATGAAACACATGAACTCATCAAA
CCTGAAAGAACAGAAGGTCAAAAACGTCTGTTCTCACTCAATGATTTGGAAAGATTACTA
GAAATTAAATCATTATTAGAAAAAGGATTTAATATCAAAGGGATTAAACAAATCATTTAT
GACTCACAAGAGCATTTAACAACAGATGAACAAGAGATAAGAAAAAAGATGATTGTAGAT
GCCACGCAAAAGCCTATTGGAGAAACTTTGCCAATAAATCGTGGTGATTTATCCCGATTT
ATTAAATAA60
120
180
240
300
360
369
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_01285
- symbol: SAOUHSC_01285
- description: glutamine synthetase repressor
- length: 122
- theoretical pI: 9.8101
- theoretical MW: 14276.5
- GRAVY: -0.546721
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions Cu(I)-responsive transcriptional regulator (TIGR02044; HMM-score: 34)Cellular processes Detoxification Hg(II)-responsive transcriptional regulator (TIGR02051; HMM-score: 33.2)Regulatory functions DNA interactions Hg(II)-responsive transcriptional regulator (TIGR02051; HMM-score: 33.2)Regulatory functions DNA interactions Zn(II)-responsive transcriptional regulator (TIGR02043; HMM-score: 33)and 4 moreRegulatory functions DNA interactions Cd(II)/Pb(II)-responsive transcriptional regulator (TIGR02047; HMM-score: 23.9)Cellular processes Detoxification redox-sensitive transcriptional activator SoxR (TIGR01950; HMM-score: 19.4)Regulatory functions DNA interactions redox-sensitive transcriptional activator SoxR (TIGR01950; HMM-score: 19.4)Mobile and extrachromosomal element functions Plasmid functions plasmid partitioning protein RepA (TIGR03453; HMM-score: 12.2)
- TheSEED :
- FemC, factor involved in methicillin resistance
- Glutamine synthetase repressor
- PFAM: HTH (CL0123) MerR_1; MerR HTH family regulatory protein (PF13411; HMM-score: 71.6)and 3 moreMerR; MerR family regulatory protein (PF00376; HMM-score: 43.5)MerR_2; MerR HTH family regulatory protein (PF13591; HMM-score: 14.5)no clan defined PDGF_N; Platelet-derived growth factor, N terminal region (PF04692; HMM-score: 13.8)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effector: binding of feedback-inhibited GlnA (glutamine synthetase)
- interaction partners:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005097
- TAT(Tat/SPI): 0.004677
- LIPO(Sec/SPII): 0.003218
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MISNDAIRRNMAVFSMSVVSKLTDLTPRQIRYYETHELIKPERTEGQKRLFSLNDLERLLEIKSLLEKGFNIKGIKQIIYDSQEHLTTDEQEIRKKMIVDATQKPIGETLPINRGDLSRFIK
⊟Peptides[edit | edit source]
- experimentally validated: PeptideAtlas [2] [3]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- sigma factors : _
- regulators: CodY* (repression) regulon, GlnR* (repression) regulon
CodY* (TF) important in Amino acid metabolism; RegPrecise GlnR* (TF) important in Nitrogen assimilation; RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [4] Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
BMC Genomics: 2009, 10;291
[PubMed:19570206] [WorldCat.org] [DOI] (I e) - ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑ 4.0 4.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)