NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_00995
- pan locus tag?: SAUPAN003261000
- symbol: SAOUHSC_00995
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
⊟Accession numbers[edit | edit source]
- Gene ID: 3920395 NCBI
- RefSeq: YP_499547 NCBI
- BioCyc: G1I0R-937 BioCyc
- MicrobesOnline: 1289460 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGTTTTCAAAAGTAAACAATCAAAAGATGTTAGAAGATTGCTTCTATATAAGAAAGAAA
GTGTTTGTAGAAGAACAAGGCGTCCCTGAGGAAAGTGAAATTGATGAATATGAATCTGAA
TCTATTCACCTCATTGGATATGATAATGGACAGCCAGTTGCCACTGCTCGAATACGCCCT
ATTAATGAAACAACTGTCAAAATAGAACGAGTAGCTGTGATGAAATCACATCGTGGACAA
GGAATGGGTAGAATGCTTATGCAAGCTGTAGAATCATTAGCTAAAGATGAAGGTTTTTAC
GTAGCTACTATGAATGCCCAATGTCATGCTATCCCATTTTATGAAAGTTTAAACTTTAAA
ATGAGAGGTAATATATTTCTTGAGGAAGGCATCGAGCATATTGAAATGACAAAAAAGTTA
ACCTCGCTTAATTAA60
120
180
240
300
360
420
435
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_00995
- symbol: SAOUHSC_00995
- description: hypothetical protein
- length: 144
- theoretical pI: 5.30054
- theoretical MW: 16555.9
- GRAVY: -0.405556
⊟Function[edit | edit source]
- reaction: EC 2.3.1.-? ExPASy
- TIGRFAM: putative N-acetyltransferase, MSMEG_0567 N-terminal domain family (TIGR04045; HMM-score: 38.8)Protein synthesis Ribosomal proteins: synthesis and modification ribosomal-protein-alanine acetyltransferase (TIGR01575; EC 2.3.1.128; HMM-score: 31.4)and 5 moreN-acyl amino acid synthase, PEP-CTERM/exosortase system-associated (TIGR03694; EC 2.3.1.-; HMM-score: 17.8)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides TDP-D-fucosamine acetyltransferase (TIGR02382; HMM-score: 15.5)Biosynthesis of cofactors, prosthetic groups, and carriers Glutathione and analogs mycothiol synthase (TIGR03448; EC 2.3.1.189; HMM-score: 15.3)Cellular processes Adaptations to atypical conditions diaminobutyrate acetyltransferase (TIGR02406; EC 2.3.1.178; HMM-score: 14.5)putative beta-lysine N-acetyltransferase (TIGR03827; EC 2.3.1.-; HMM-score: 12.5)
- TheSEED :
- GNAT family acetyltransferase YjcF
- PFAM: Acetyltrans (CL0257) Acetyltransf_10; Acetyltransferase (GNAT) domain (PF13673; HMM-score: 80.7)and 6 moreAcetyltransf_1; Acetyltransferase (GNAT) family (PF00583; HMM-score: 59.4)Acetyltransf_7; Acetyltransferase (GNAT) domain (PF13508; HMM-score: 44.6)Acetyltransf_9; Acetyltransferase (GNAT) domain (PF13527; HMM-score: 27.6)Acetyltransf_CG; GCN5-related N-acetyl-transferase (PF14542; HMM-score: 26.5)Acetyltransf_5; Acetyltransferase (GNAT) domain (PF13444; HMM-score: 23.4)FR47; FR47-like protein (PF08445; HMM-score: 20.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003957
- TAT(Tat/SPI): 0.000261
- LIPO(Sec/SPII): 0.000439
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MFSKVNNQKMLEDCFYIRKKVFVEEQGVPEESEIDEYESESIHLIGYDNGQPVATARIRPINETTVKIERVAVMKSHRGQGMGRMLMQAVESLAKDEGFYVATMNAQCHAIPFYESLNFKMRGNIFLEEGIEHIEMTKKLTSLN
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas [2] [3]
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SAOUHSC_02511 (rplD) 50S ribosomal protein L4 [4] (data from MRSA252) SAOUHSC_02477 (rpsI) 30S ribosomal protein S9 [4] (data from MRSA252) SAOUHSC_00529 elongation factor G [4] (data from MRSA252) SAOUHSC_00795 glyceraldehyde-3-phosphate dehydrogenase [4] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [5] Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
BMC Genomics: 2009, 10;291
[PubMed:19570206] [WorldCat.org] [DOI] (I e) - ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑ 4.0 4.1 4.2 4.3 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p) - ↑ 5.0 5.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
⊟Relevant publications[edit | edit source]
T Oshida, M Sugai, H Komatsuzawa, Y M Hong, H Suginaka, A Tomasz
A Staphylococcus aureus autolysin that has an N-acetylmuramoyl-L-alanine amidase domain and an endo-beta-N-acetylglucosaminidase domain: cloning, sequence analysis, and characterization.
Proc Natl Acad Sci U S A: 1995, 92(1);285-9
[PubMed:7816834] [WorldCat.org] [DOI] (P p)