From AureoWiki
Revision as of 21:04, 10 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "")
Jump to navigation Jump to search

NCBI date : _

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00853
  • pan locus tag?: SAUPAN003014000
  • symbol: SAOUHSC_00853
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_00853
  • symbol: SAOUHSC_00853
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 823486..823800
  • length: 315
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

  • Gene ID: 3918984 NCBI
  • gene Genbank : _

⊟Phenotype[edit | edit source]

  • Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGTATTTTGTTTTAGCAATATTTACAATAATCAGTGCCAGTGTAAGTTTAGGTTATTCA
    ATTCAAGCATGTGCATCTAGCCATAATATAAATGCATATTATGCACTTAGTCGAAGCTTA
    CCTTTATTTTTATTAGCTATTTTTTCTTTAGTCATTCATAGTGCTATATTTTTGATAACT
    ATATCCATTGCAATGATCTTAGTTCAATTTTTAGATGCGATTGTTGGTTATAAAAGTGAA
    GATGTCTTTAAAACTTATGGTCCATTAGCAACATCTGTAGTGAACTTAATATTATTAATA
    GTTTTCTTATTTTAA
    60
    120
    180
    240
    300
    315

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAOUHSC_00853
  • symbol: SAOUHSC_00853
  • description: hypothetical protein
  • length: 104
  • theoretical pI: 7.50298
  • theoretical MW: 11415.6
  • GRAVY: 1.39712

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG01108136: hypothetical protein
  • PFAM:
    no clan defined PIRT; Phosphoinositide-interacting protein family (PF15099; HMM-score: 14.7)
    and 2 more
    DUF996; Protein of unknown function (DUF996) (PF06195; HMM-score: 11.5)
    YtpI; YtpI-like protein (PF14007; HMM-score: 8)

⊟Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • interaction partners:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0
    • Signal peptide possibility: 1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: Signal peptide LIPO(Sec/SPII) length 23 aa
    • SP(Sec/SPI): 0.020046
    • TAT(Tat/SPI): 0.001283
    • LIPO(Sec/SPII): 0.780004
    • Cleavage Site: CS pos: 23-24. IQA-CA. Pr: 0.7588
  • predicted transmembrane helices (TMHMM): 3

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MYFVLAIFTIISASVSLGYSIQACASSHNINAYYALSRSLPLFLLAIFSLVIHSAIFLITISIAMILVQFLDAIVGYKSEDVFKTYGPLATSVVNLILLIVFLF

⊟Peptides[edit | edit source]

  • experimentally validated:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • sigma factors : _
  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SAOUHSC_00853&oldid=71203"