NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_00526
- pan locus tag?: SAUPAN002316000
- symbol: SAOUHSC_00526
- pan gene symbol?: rplGB
- synonym:
- product: 50S ribosomal protein L7Ae-like protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
⊟Accession numbers[edit | edit source]
- Gene ID: 3920379 NCBI
- RefSeq: YP_499098 NCBI
- BioCyc: G1I0R-496 BioCyc
- MicrobesOnline: 1289008 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241TTGTCTAAGGAAAAAGTTGCACGCTTTAACAAACAACATTTTGTAGTTGGTCTTAAAGAA
ACGCTTAAAGCGTTAAAGAAAGATCAAGTTACATCTTTGATTATTGCTGAAGACGTTGAA
GTATATTTAATGACTCGCGTGTTAAGCCAAATCAATCAGAAAAATATACCTGTATCTTTT
TTCAAAAGCAAACATGCTTTGGGTAAACATGTAGGTATTAACGTCAATGCGACAATAGTA
GCATTGATTAAATGA60
120
180
240
255
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_00526
- symbol: SAOUHSC_00526
- description: 50S ribosomal protein L7Ae-like protein
- length: 84
- theoretical pI: 10.8182
- theoretical MW: 9446.19
- GRAVY: 0.0607143
⊟Function[edit | edit source]
- TIGRFAM: ribosomal protein eL8 (TIGR03677; HMM-score: 37.8)
- TheSEED :
- Firmicutes ribosomal L7Ae family protein
- PFAM: PELOTA (CL0101) Ribosomal_L7Ae; Ribosomal protein L7Ae/L30e/S12e/Gadd45 family (PF01248; HMM-score: 39.1)and 3 moreeRF1_3; eRF1 domain 3 (PF03465; HMM-score: 16.5)no clan defined DUF1694; Protein of unknown function (DUF1694) (PF07997; HMM-score: 13.8)Cas_Cas1; CRISPR associated protein Cas1 (PF01867; HMM-score: 13)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001767
- TAT(Tat/SPI): 0.000214
- LIPO(Sec/SPII): 0.00029
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSKEKVARFNKQHFVVGLKETLKALKKDQVTSLIIAEDVEVYLMTRVLSQINQKNIPVSFFKSKHALGKHVGINVNATIVALIK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: rpoB > SAOUHSC_00525 > SAOUHSC_00526 > rpsL > SAOUHSC_00528 > SAOUHSC_00529 > SAOUHSC_00530predicted SigA promoter [2] : S183 > rplJ > rplL > S184 > SAOUHSC_00523 > S185 > rpoB > S186 > SAOUHSC_00525 > SAOUHSC_00526 > S187 > rpsL > SAOUHSC_00528 > S188 > SAOUHSC_00529 > S189 > SAOUHSC_00530predicted SigA promoter [2] : SAOUHSC_00523 > S185 > rpoB > S186 > SAOUHSC_00525 > SAOUHSC_00526 > S187 > rpsL > SAOUHSC_00528 > S188 > SAOUHSC_00529 > S189 > SAOUHSC_00530predicted SigA promoter [2] : S185 > rpoB > S186 > SAOUHSC_00525 > SAOUHSC_00526 > S187 > rpsL > SAOUHSC_00528 > S188 > SAOUHSC_00529 > S189 > SAOUHSC_00530predicted SigA promoter [2] : SAOUHSC_00526 > S187 > rpsL > SAOUHSC_00528 > S188 > SAOUHSC_00529 > S189 > SAOUHSC_00530
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [2] Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
BMC Genomics: 2009, 10;291
[PubMed:19570206] [WorldCat.org] [DOI] (I e) - ↑ 2.0 2.1 2.2 2.3 2.4 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
⊟Relevant publications[edit | edit source]
A Wada, H Watanabe
Penicillin-binding protein 1 of Staphylococcus aureus is essential for growth.
J Bacteriol: 1998, 180(10);2759-65
[PubMed:9573165] [WorldCat.org] [DOI] (P p)