⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_00503
- pan locus tag?: SAUPAN002288000
- symbol: SAOUHSC_00503
- pan gene symbol?: mcsA
- synonym:
- product: UvrB/UvrC motif-containing protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
⊟Accession numbers[edit | edit source]
- Gene ID: 3920415 NCBI
- gene Genbank : _
⊟Phenotype[edit | edit source]
- Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGGTGTGTCAAACTTGTGCTGAGGGGCACCATCCGTGGAATCAAGCTAATGAACAACCT
GAATATCAAGAACATCAAGATAATTTCGAAGAAGCATTTGTTGTTAAGCAAATTTTACAA
CATTTAGCTACGAAACATGGAATTAATTTTCAAGAAGTAGCGTTTAAAGAAGAAAAACGT
TGCCCATCATGTCATATGACTTTGAAAGATATTGCACATGTTGGTAAATTTGGGTGTGCT
AATTGTTATGCAACATTTAAAGATGACATCATTGATATCGTCCGCAGAGTTCAAGGTGGA
CAATTTGAGCACGTTGGAAAGACACCACATTCTTCACATAAAAAGATAGCTTTAAAGCGA
AAAATCGAAGAAAAGAATGAATATTTGAAAAAACTTATTGAAATCCAAGATTTTGAGGAA
GCAGCCATTGTTAGAGATGAAATTAAAGCACTAAAAGCTGAGAGTGAGGTGCAACATGAT
GACGCATAA60
120
180
240
300
360
420
480
489
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_00503
- symbol: SAOUHSC_00503
- description: UvrB/UvrC motif-containing protein
- length: 162
- theoretical pI: 6.42997
- theoretical MW: 18710
- GRAVY: -0.72037
⊟Function[edit | edit source]
- TIGRFAM: DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit B (TIGR00631; EC 3.1.25.-; HMM-score: 14.8)Transport and binding proteins Cations and iron carrying compounds sodium/hydrogen antiporter (TIGR00844; HMM-score: 12)
- TheSEED :
- Protein-arginine kinase activator protein McsA
- PFAM: no clan defined UVR; UvrB/uvrC motif (PF02151; HMM-score: 23)and 6 moreZn_Beta_Ribbon (CL0167) OrfB_Zn_ribbon; Putative transposase DNA-binding domain (PF07282; HMM-score: 16.5)Zn_Tnp_IS1595; Transposase zinc-ribbon domain (PF12760; HMM-score: 16.5)Zn-ribbon_8; Zinc ribbon domain (PF09723; HMM-score: 11.5)Multiheme_cytos (CL0317) Cytochrom_CIII; Class III cytochrome C family (PF02085; HMM-score: 9.6)Zn_Beta_Ribbon (CL0167) zinc-ribbons_6; zinc-ribbons (PF07191; HMM-score: 8.1)RING (CL0229) Prok-RING_1; Prokaryotic RING finger family 1 (PF14446; HMM-score: 6.4)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- interaction partners:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002846
- TAT(Tat/SPI): 0.000231
- LIPO(Sec/SPII): 0.000513
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MVCQTCAEGHHPWNQANEQPEYQEHQDNFEEAFVVKQILQHLATKHGINFQEVAFKEEKRCPSCHMTLKDIAHVGKFGCANCYATFKDDIIDIVRRVQGGQFEHVGKTPHSSHKKIALKRKIEEKNEYLKKLIEIQDFEEAAIVRDEIKALKAESEVQHDDA
⊟Peptides[edit | edit source]
- experimentally validated: PeptideAtlas [2] [3]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SAOUHSC_00502 > SAOUHSC_00503 > SAOUHSC_00504 > SAOUHSC_00505predicted SigA promoter [4] : SAOUHSC_00502 > S169 > SAOUHSC_00503 > SAOUHSC_00504 > SAOUHSC_00505 > S170 > S171 > S172 > SAOUHSC_00507 > SAOUHSC_00508 > S173 > S174 > gltX > S175 > S176 > SAOUHSC_00510
⊟Regulation[edit | edit source]
- sigma factors : _
- regulator: CtsR* (repression) regulon
CtsR* (TF) important in Heat shock response; transcription unit transferred from N315 data RegPrecise [4]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [4] Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
BMC Genomics: 2009, 10;291
[PubMed:19570206] [WorldCat.org] [DOI] (I e) - ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑ 4.0 4.1 4.2 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)