From AureoWiki
Jump to navigation Jump to search
(Created page with "<protect> =Summary= * <aureodatabase>organism</aureodatabase> * <aureodatabase>locus</aureodatabase> * <aureodatabase>pan locus</aureodatabase> * <aureodatabase>gene symbol</...")
 
m (Text replacement - "title=SACOL0100" to "title={{PAGENAMEE}}")
Line 43: Line 43:
==Phenotype==
==Phenotype==
</protect>
</protect>
* Share your knowledge and add information here. [<span class="plainlinks">[http://www.protecs.uni-greifswald.de/aureowiki/index.php?title=SACOL0100&action=edit&section=6 edit]</span>]
* Share your knowledge and add information here. [<span class="plainlinks">[http://www.protecs.uni-greifswald.de/aureowiki/index.php?title={{PAGENAMEE}}&action=edit&section=6 edit]</span>]


<protect>
<protect>

Revision as of 18:49, 28 October 2014

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_00503
  • symbol: SAOUHSC_00503
  • product: UvrB/UvrC motif-containing protein
  • replicon: chromosome
  • strand: +
  • coordinates: 503727..504215
  • length: 489
  • essential: no [1] DEG other strains

Accession numbers[edit | edit source]

  • Gene ID: 3920415 NCBI
  • gene Genbank : _

Phenotype[edit | edit source]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGGTGTGTCAAACTTGTGCTGAGGGGCACCATCCGTGGAATCAAGCTAATGAACAACCT
    GAATATCAAGAACATCAAGATAATTTCGAAGAAGCATTTGTTGTTAAGCAAATTTTACAA
    CATTTAGCTACGAAACATGGAATTAATTTTCAAGAAGTAGCGTTTAAAGAAGAAAAACGT
    TGCCCATCATGTCATATGACTTTGAAAGATATTGCACATGTTGGTAAATTTGGGTGTGCT
    AATTGTTATGCAACATTTAAAGATGACATCATTGATATCGTCCGCAGAGTTCAAGGTGGA
    CAATTTGAGCACGTTGGAAAGACACCACATTCTTCACATAAAAAGATAGCTTTAAAGCGA
    AAAATCGAAGAAAAGAATGAATATTTGAAAAAACTTATTGAAATCCAAGATTTTGAGGAA
    GCAGCCATTGTTAGAGATGAAATTAAAGCACTAAAAGCTGAGAGTGAGGTGCAACATGAT
    GACGCATAA
    60
    120
    180
    240
    300
    360
    420
    480
    489

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_00503
  • symbol: SAOUHSC_00503
  • description: UvrB/UvrC motif-containing protein
  • length: 162
  • theoretical pI: 6.42997
  • theoretical MW: 18710
  • GRAVY: -0.72037

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit B (TIGR00631; EC 3.1.25.-; HMM-score: 14.8)
    Metabolism Transport and binding proteins Cations and iron carrying compounds sodium/hydrogen antiporter (TIGR00844; HMM-score: 12)
  • TheSEED  :
    • Protein-arginine kinase activator protein McsA
    Protein Metabolism Protein degradation Proteolysis in bacteria, ATP-dependent  Nucleotide excision repair protein, with UvrB/UvrC motif
  • PFAM:
    no clan defined UVR; UvrB/uvrC motif (PF02151; HMM-score: 23)
    and 6 more
    Zn_Beta_Ribbon (CL0167) OrfB_Zn_ribbon; Putative transposase DNA-binding domain (PF07282; HMM-score: 16.5)
    Zn_Tnp_IS1595; Transposase zinc-ribbon domain (PF12760; HMM-score: 16.5)
    Zn-ribbon_8; Zinc ribbon domain (PF09723; HMM-score: 11.5)
    Multiheme_cytos (CL0317) Cytochrom_CIII; Class III cytochrome C family (PF02085; HMM-score: 9.6)
    Zn_Beta_Ribbon (CL0167) zinc-ribbons_6; zinc-ribbons (PF07191; HMM-score: 8.1)
    RING (CL0229) Prok-RING_1; Prokaryotic RING finger family 1 (PF14446; HMM-score: 6.4)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • interaction partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002846
    • TAT(Tat/SPI): 0.000231
    • LIPO(Sec/SPII): 0.000513
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 88194284 NCBI
  • UniProt: Q2G0P7 UniProt
  • protein Genbank : _
  • RefSeq: YP_499076 NCBI

Protein sequence[edit | edit source]

  • MVCQTCAEGHHPWNQANEQPEYQEHQDNFEEAFVVKQILQHLATKHGINFQEVAFKEEKRCPSCHMTLKDIAHVGKFGCANCYATFKDDIIDIVRRVQGGQFEHVGKTPHSSHKKIALKRKIEEKNEYLKKLIEIQDFEEAAIVRDEIKALKAESEVQHDDA

Peptides[edit | edit source]

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • sigma factors : _
  • regulator: CtsR* (repression) regulon
    CtsR*(TF)important in Heat shock response; transcription unit transferred from N315 data RegPrecise  [4]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
    Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
    BMC Genomics: 2009, 10;291
    [PubMed:19570206] [WorldCat.org] [DOI] (I e)
  2. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  4. 4.0 4.1 4.2 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]