From AureoWiki
Revision as of 23:32, 10 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "gene Genbank" to "gene RefSeq")
Jump to navigation Jump to search

NCBI date : _

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00215
  • pan locus tag?: SAUPAN001117000
  • symbol: SAOUHSC_00215
  • pan gene symbol?: —
  • synonym:
  • product: PTS system transporter

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_00215
  • symbol: SAOUHSC_00215
  • product: PTS system transporter
  • replicon: chromosome
  • strand: +
  • coordinates: 235347..235625
  • length: 279
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

  • Gene ID: 3920291 NCBI
  • RefSeq: YP_498810 NCBI

⊟Phenotype[edit | edit source]

  • Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAAACAAGTATTAGTAGCGTGTGGTGCAGGTATTGCAACGTCAACAGTAGTAAATAAT
    GCAATTGAAGAAATGGCAAAGGAACACAATATTAAAGTAGATATTAAACAAATCAAAATT
    ACAGAAGTTGGACCTTATGAAGACACTGCAGATTTATTAGTTACAACTGCAATGACAAAA
    AAAGAATATAAATTCCCAGTTATCAACGCACGTAATTTCTTAACTGGTATTGGTATTGAA
    GAAACAAAACAACAAATCTTAACAGAGTTACAAAAATAA
    60
    120
    180
    240
    279

⊟Protein[edit | edit source]

Protein Data Bank: 5GQS

⊟General[edit | edit source]

  • locus tag: SAOUHSC_00215
  • symbol: SAOUHSC_00215
  • description: PTS system transporter
  • length: 92
  • theoretical pI: 5.86126
  • theoretical MW: 10178.8
  • GRAVY: -0.105435

⊟Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids PTS system, lactose/cellobiose family IIB component (TIGR00853; HMM-score: 29.2)
    Signal transduction Signal transduction PTS PTS system, lactose/cellobiose family IIB component (TIGR00853; HMM-score: 29.2)
    and 2 more
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids PTS system, Fru family, IIB component (TIGR00829; EC 2.7.1.69; HMM-score: 16.7)
    Signal transduction Signal transduction PTS PTS system, Fru family, IIB component (TIGR00829; EC 2.7.1.69; HMM-score: 16.7)
  • TheSEED  :
    • PTS system, D-arabitol/D-xylitol-specific IIB component, galactitol family
    Carbohydrates Monosaccharides D-Tagatose and Galactitol Utilization  PTS system, galactitol-specific IIB component (EC 2.7.1.69)
  • PFAM:
    Phosphatase (CL0031) PTS_IIB; PTS system, Lactose/Cellobiose specific IIB subunit (PF02302; HMM-score: 63.3)
    and 1 more
    NADP_Rossmann (CL0063) THF_DHG_CYH_C; Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain (PF02882; HMM-score: 13.7)

⊟Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • interaction partners:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 0.67
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.471099
    • TAT(Tat/SPI): 0.002537
    • LIPO(Sec/SPII): 0.021079
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI: 88194023 NCBI
  • UniProt: Q2G2B6 UniProt
  • protein Genbank : _
  • RefSeq: YP_498810 NCBI

⊟Protein sequence[edit | edit source]

  • MKQVLVACGAGIATSTVVNNAIEEMAKEHNIKVDIKQIKITEVGPYEDTADLLVTTAMTKKEYKFPVINARNFLTGIGIEETKQQILTELQK

⊟Peptides[edit | edit source]

  • experimentally validated:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • sigma factors : _
  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SAOUHSC_00215&oldid=75713"