From AureoWiki
Revision as of 16:03, 23 May 2017 by Robot (talk | contribs) (Created page with "<protect> <aureodatabase>annotation</aureodatabase> =Summary= * <aureodatabase>organism</aureodatabase> * <aureodatabase>locus</aureodatabase> * <aureodatabase>pan locus</au...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS14625
  • pan locus tag?:
  • symbol: SACOL_RS14625
  • pan gene symbol?:
  • synonym:
  • product: lactococcin 972 family bacteriocin

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS14625
  • symbol: SACOL_RS14625
  • product: lactococcin 972 family bacteriocin
  • replicon: chromosome
  • strand: +
  • coordinates: 1046625..1046897
  • length: 273
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_002951 (1046625..1046897) NCBI
  • BioCyc: G1G4B-1120 BioCyc
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATTTTTGGCACTATATTATATTTAACTTTAGCACTTGGATTATCAACAGCAGCTTATGCA
    TCTACAGAATACGCAGAAGGAGGCACTTGGAGTCATGGTGTCGGCAGTAAGTATGTTTGG
    TCGTATTATTATCATGGTCATAAAGGACATGGTGCAACAGCTATTGGAAAATATAAATCA
    TTTAGTGGTTATACAAGAGCTGGTGTAAAAGCAAAAGCATCAGCTACTAAACATAATTGG
    TGGGTCAATAGAGCGTATTATAACATTTATTAA
    60
    120
    180
    240
    273

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL_RS14625
  • symbol: SACOL_RS14625
  • description: lactococcin 972 family bacteriocin
  • length: 90
  • theoretical pI: 9.97301
  • theoretical MW: 9987.12
  • GRAVY: -0.304444

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Toxin production and resistance bacteriocin, lactococcin 972 family (TIGR01653; HMM-score: 35.8)
  • TheSEED:
  • PFAM:
    no clan defined Lactococcin_972; Bacteriocin (Lactococcin_972) (PF09683; HMM-score: 48.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helix: 1
  • LocateP:
  • SignalP: Signal peptide SP(Sec/SPI) length 20 aa
    • SP(Sec/SPI): 0.98058
    • TAT(Tat/SPI): 0.005922
    • LIPO(Sec/SPII): 0.010218
    • Cleavage Site: CS pos: 20-21. AYA-ST. Pr: 0.7636
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_078061421 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MFGTILYLTLALGLSTAAYASTEYAEGGTWSHGVGSKYVWSYYYHGHKGHGATAIGKYKSFSGYTRAGVKAKASATKHNWWVNRAYYNIY

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]