From AureoWiki
Revision as of 18:07, 10 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "gene Genbank" to "gene RefSeq")
Jump to navigation Jump to search

NCBI date : _

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS11170 [old locus tag: SACOL2134 ]
  • pan locus tag?: SAUPAN005439000
  • symbol: SACOL_RS11170
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS11170 [old locus tag: SACOL2134 ]
  • symbol: SACOL_RS11170
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2195831..2196061
  • length: 231
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: WP_000808817 NCBI

⊟Phenotype[edit | edit source]

  • Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    TTGAAGCAATTTCTATATATTGCGTTAGTATGTGGTGTGATAGCAGGTCTTGGTGCTTTC
    TTACATATACCGCAGTATCCGAGCATGACAATTCCACGTATAGTAGCTATTTTAGGAATT
    ATCAGTGCTATGTTGACTTTTAAAGACAAGCAAATCAGCGCCTCATTAAAGTTTAGCGCA
    TTGTTAATTAATGTGCTGCCATTATGCGGTACCTTTGTAGCTTCAAATTAA
    60
    120
    180
    231

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL_RS11170 [old locus tag: SACOL2134 ]
  • symbol: SACOL_RS11170
  • description: hypothetical protein
  • length: 76
  • theoretical pI: 9.85612
  • theoretical MW: 8153.93
  • GRAVY: 1.11447

⊟Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Chemotaxis and motility flagellar biosynthetic protein FliQ (TIGR01402; HMM-score: 13.9)
  • TheSEED: see SACOL2134
  • PFAM:
    Holin-V (CL0562) Phage_holin_5_2; Phage holin family Hol44, in holin superfamily V (PF16079; HMM-score: 14.4)
    and 1 more
    no clan defined PspC; PspC domain (PF04024; HMM-score: 10.2)

⊟Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • interaction partners:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.112464
    • TAT(Tat/SPI): 0.005356
    • LIPO(Sec/SPII): 0.103092
  • predicted transmembrane helices (TMHMM): 3

⊟Accession numbers[edit | edit source]

  • GI: 446731561 NCBI
  • UniProt: see SACOL2134
  • protein Genbank : _
  • RefSeq: WP_000808817 NCBI

⊟Protein sequence[edit | edit source]

  • MKQFLYIALVCGVIAGLGAFLHIPQYPSMTIPRIVAILGIISAMLTFKDKQISASLKFSALLINVLPLCGTFVASN

⊟Peptides[edit | edit source]

  • experimentally validated:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • sigma factors : _
  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SACOL_RS11170&oldid=65598"