Jump to navigation
Jump to search
m (Text replacement - "gene Genbank" to "gene RefSeq") |
m (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "") |
||
Line 1: | Line 1: | ||
__TOC__ | |||
<protect> | <protect> | ||
<aureodatabase> | <aureodatabase>annotation</aureodatabase> | ||
=Summary= | =Summary= | ||
* <aureodatabase>organism</aureodatabase> | *<aureodatabase>organism</aureodatabase> | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>pan locus</aureodatabase> | *<aureodatabase>pan locus</aureodatabase> | ||
* <aureodatabase>gene symbol</aureodatabase> | *<aureodatabase>gene symbol</aureodatabase> | ||
* <aureodatabase>pan gene symbol</aureodatabase> | *<aureodatabase>pan gene symbol</aureodatabase> | ||
* <aureodatabase>gene synonyms</aureodatabase> | *<aureodatabase>gene synonyms</aureodatabase> | ||
* <aureodatabase>product</aureodatabase> | *<aureodatabase>product</aureodatabase> | ||
</protect> | </protect> | ||
Line 24: | Line 25: | ||
==General== | ==General== | ||
* <aureodatabase>gene type</aureodatabase> | *<aureodatabase>gene type</aureodatabase> | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>gene symbol</aureodatabase> | *<aureodatabase>gene symbol</aureodatabase> | ||
* <aureodatabase>product</aureodatabase> | *<aureodatabase>product</aureodatabase> | ||
* <aureodatabase>gene replicon</aureodatabase> | *<aureodatabase>gene replicon</aureodatabase> | ||
* <aureodatabase>strand</aureodatabase> | *<aureodatabase>strand</aureodatabase> | ||
* <aureodatabase>gene coordinates</aureodatabase> | *<aureodatabase>gene coordinates</aureodatabase> | ||
* <aureodatabase>gene length</aureodatabase> | *<aureodatabase>gene length</aureodatabase> | ||
* <aureodatabase>essential</aureodatabase> | *<aureodatabase>essential</aureodatabase> | ||
*<aureodatabase>gene comment</aureodatabase> | |||
</protect> | </protect> | ||
Line 38: | Line 40: | ||
==Accession numbers== | ==Accession numbers== | ||
* <aureodatabase>gene | *<aureodatabase>gene location</aureodatabase> | ||
* <aureodatabase>gene | *<aureodatabase>gene BioCyc</aureodatabase> | ||
*<aureodatabase>gene MicrobesOnline</aureodatabase> | |||
</protect> | </protect> | ||
<protect> | <protect> | ||
==Phenotype== | ==Phenotype== | ||
</protect> | </protect> | ||
Share your knowledge and add information here. [<span class="plainlinks">[//aureowiki.med.uni-greifswald.de/index.php?title={{PAGENAMEE}}&veaction=edit§ion=6 edit]</span>] | |||
<protect> | <protect> | ||
==DNA sequence== | ==DNA sequence== | ||
* <aureodatabase>gene sequence</aureodatabase> | *<aureodatabase>gene sequence</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
<aureodatabase>RNA regulated operons</aureodatabase> | |||
</protect> | |||
<protect> | |||
=Protein= | =Protein= | ||
<aureodatabase>protein 3D view</aureodatabase> | <aureodatabase>protein 3D view</aureodatabase> | ||
==General== | ==General== | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>protein symbol</aureodatabase> | *<aureodatabase>protein symbol</aureodatabase> | ||
* <aureodatabase>protein description</aureodatabase> | *<aureodatabase>protein description</aureodatabase> | ||
* <aureodatabase>protein length</aureodatabase> | *<aureodatabase>protein length</aureodatabase> | ||
* <aureodatabase>theoretical pI</aureodatabase> | *<aureodatabase>theoretical pI</aureodatabase> | ||
* <aureodatabase>theoretical MW</aureodatabase> | *<aureodatabase>theoretical MW</aureodatabase> | ||
* <aureodatabase>GRAVY</aureodatabase> | *<aureodatabase>GRAVY</aureodatabase> | ||
</protect> | </protect> | ||
Line 71: | Line 77: | ||
==Function== | ==Function== | ||
* <aureodatabase>protein reaction</aureodatabase> | *<aureodatabase>protein reaction</aureodatabase> | ||
* <aureodatabase>protein TIGRFAM</aureodatabase> | *<aureodatabase>protein TIGRFAM</aureodatabase> | ||
* <aureodatabase>protein TheSeed</aureodatabase> | *<aureodatabase>protein TheSeed</aureodatabase> | ||
* <aureodatabase>protein PFAM</aureodatabase> | *<aureodatabase>protein PFAM</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
==Structure, modifications & | ==Structure, modifications & cofactors== | ||
* <aureodatabase>protein domains</aureodatabase> | *<aureodatabase>protein domains</aureodatabase> | ||
* <aureodatabase>protein modifications</aureodatabase> | *<aureodatabase>protein modifications</aureodatabase> | ||
* <aureodatabase>protein cofactors</aureodatabase> | *<aureodatabase>protein cofactors</aureodatabase> | ||
* <aureodatabase>protein effectors</aureodatabase> | *<aureodatabase>protein effectors</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein regulated operons</aureodatabase> | ||
</protect> | </protect> | ||
Line 90: | Line 96: | ||
==Localization== | ==Localization== | ||
* <aureodatabase>protein Psortb</aureodatabase> | *<aureodatabase>protein Psortb</aureodatabase> | ||
* <aureodatabase>protein LocateP</aureodatabase> | *<aureodatabase>protein LocateP</aureodatabase> | ||
* <aureodatabase>protein SignalP</aureodatabase> | *<aureodatabase>protein SignalP</aureodatabase> | ||
* <aureodatabase>protein TMHMM</aureodatabase> | *<aureodatabase>protein TMHMM</aureodatabase> | ||
</protect> | </protect> | ||
Line 99: | Line 105: | ||
==Accession numbers== | ==Accession numbers== | ||
* <aureodatabase>protein GI</aureodatabase> | *<aureodatabase>protein GI</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein RefSeq</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein UniProt</aureodatabase> | ||
</protect> | </protect> | ||
Line 108: | Line 113: | ||
==Protein sequence== | ==Protein sequence== | ||
* <aureodatabase>protein sequence</aureodatabase> | *<aureodatabase>protein sequence</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
== | ==Experimental data== | ||
* <aureodatabase>protein validated peptides</aureodatabase> | *<aureodatabase>protein validated peptides</aureodatabase> | ||
*<aureodatabase>protein validated localization</aureodatabase> | |||
*<aureodatabase>protein validated quantitative data</aureodatabase> | |||
*<aureodatabase>protein partners</aureodatabase> | |||
</protect> | </protect> | ||
Line 125: | Line 133: | ||
==Operon== | ==Operon== | ||
* <aureodatabase>operons</aureodatabase> | *<aureodatabase>operons</aureodatabase> | ||
</protect> | </protect> | ||
Line 131: | Line 139: | ||
==Regulation== | ==Regulation== | ||
*<aureodatabase>regulators</aureodatabase> | |||
* <aureodatabase>regulators</aureodatabase> | |||
</protect> | </protect> | ||
Line 138: | Line 145: | ||
==Transcription pattern== | ==Transcription pattern== | ||
* <aureodatabase>expression browser</aureodatabase> | *<aureodatabase>expression browser</aureodatabase> | ||
</protect> | </protect> | ||
Line 144: | Line 151: | ||
==Protein synthesis (provided by Aureolib)== | ==Protein synthesis (provided by Aureolib)== | ||
* <aureodatabase>protein synthesis Aureolib</aureodatabase> | *<aureodatabase>protein synthesis Aureolib</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
== | ==Protein stability== | ||
* <aureodatabase>protein half-life</aureodatabase> | *<aureodatabase>protein half-life</aureodatabase> | ||
</protect> | </protect> | ||
Latest revision as of 10:34, 11 March 2016
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS10475 [old locus tag: SACOL2004 ]
- pan locus tag?: SAUPAN005190000
- symbol: SACOL_RS10475
- pan gene symbol?: lukG
- synonym: lukB
- product: gamma-hemolysin subunit B
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS10475 [old locus tag: SACOL2004 ]
- symbol: SACOL_RS10475
- product: gamma-hemolysin subunit B
- replicon: chromosome
- strand: -
- coordinates: 2064956..2065972
- length: 1017
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901
961ATGATTAAACAACTATGTAAAAATATCACAATTTGTACGTTAGCACTATCGACTACTTTC
ACTGTATTACCAGCTACTTCATTTGCAAAGATTAATTCTGAAATCAAACAAGTTTCTGAG
AAGAATCTTGATGGTGATACTAAAATGTATACACGTACAGCTACAACAAGTGATAGTCAA
AAAAATATTACTCAAAGCTTACAATTTAATTTCTTAACTGAACCTAATTATGATAAAGAA
ACAGTATTTATTAAAGCAAAAGGTACAATTGGTAGTGGTTTGAGAATTTTAGACCCAAAT
GGTTATTGGAATAGTACATTAAGATGGCCTGGATCTTATTCAGTTTCAATTCAAAATGTT
GATGACAACAACAATACAAATGTGACTGACTTTGCACCAAAAAATCAGGATGAATCAAGA
GAAGTTAAATATACGTATGGTTATAAAACAGGTGGAGATTTTTCGATTAATCGTGGAGGC
TTAACTGGAAATATTACAAAAGAGAGTAATTATTCAGAGACGATTAGTTATCAACAACCA
TCATATCGTACATTACTTGATCAATCTACGTCACATAAAGGTGTAGGTTGGAAAGTAGAA
GCACATTTGATAAATAATATGGGACATGACCATACGAGACAATTAACTAATGATAGTGAT
AATAGAACTAAAAGTGAAATTTTTTCTTTAACACGAAATGGAAATTTATGGGCGAAAGAT
AATTTCACACCTAAAGACAAAATGCCTGTAACTGTGTCTGAAGGGTTTAATCCAGAATTT
TTAGCTGTTATGTCACATGATAAAAAAGACAAAGGTAAATCACAATTTGTTGTTCATTAT
AAAAGATCAATGGATGAGTTTAAAATAGATTGGAATCGCCATGGTTTCTGGGGCTATTGG
TCTGGTGAAAACCATGTAGATAAAAAAGAAGAAAAATTATCAGCATTATATGAAGTTGAT
TGGAAGACACATAATGTGAAGTTTGTAAAAGTACTTAATGATAATGAAAAGAAATAA60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
960
1017
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS10475 [old locus tag: SACOL2004 ]
- symbol: SACOL_RS10475
- description: gamma-hemolysin subunit B
- length: 338
- theoretical pI: 9.06326
- theoretical MW: 38685.8
- GRAVY: -0.845858
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Toxin production and resistance beta-channel forming cytolysin (TIGR01002; HMM-score: 262.6)
- TheSEED: see SACOL2004
- PFAM: Leukocidin (CL0636) Leukocidin; Leukocidin/Hemolysin toxin family (PF07968; HMM-score: 294)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.09
- Cellwall Score: 0.18
- Extracellular Score: 9.73
- Internal Helix: 1
- LocateP:
- SignalP: Signal peptide SP(Sec/SPI) length 29 aa
- SP(Sec/SPI): 0.982212
- TAT(Tat/SPI): 0.00438
- LIPO(Sec/SPII): 0.004586
- Cleavage Site: CS pos: 29-30. SFA-KI. Pr: 0.8304
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIKQLCKNITICTLALSTTFTVLPATSFAKINSEIKQVSEKNLDGDTKMYTRTATTSDSQKNITQSLQFNFLTEPNYDKETVFIKAKGTIGSGLRILDPNGYWNSTLRWPGSYSVSIQNVDDNNNTNVTDFAPKNQDESREVKYTYGYKTGGDFSINRGGLTGNITKESNYSETISYQQPSYRTLLDQSTSHKGVGWKVEAHLINNMGHDHTRQLTNDSDNRTKSEIFSLTRNGNLWAKDNFTPKDKMPVTVSEGFNPEFLAVMSHDKKDKGKSQFVVHYKRSMDEFKIDWNRHGFWGYWSGENHVDKKEEKLSALYEVDWKTHNVKFVKVLNDNEKK
⊟Experimental data[edit | edit source]
- experimentally validated: see SACOL2004
- protein localization: see SACOL2004
- quantitative data / protein copy number per cell:
- interaction partners:
SACOL_RS00470 peptidoglycan-binding protein LysM [1] (data from MRSA252) SACOL_RS01135 L-lactate dehydrogenase [1] (data from MRSA252) SACOL_RS01530 5'-nucleotidase, lipoprotein e(P4) family [1] (data from MRSA252) SACOL_RS02200 30S ribosomal protein S6 [1] (data from MRSA252) SACOL_RS02210 30S ribosomal protein S18 [1] (data from MRSA252) SACOL_RS02285 alkyl hydroperoxide reductase subunit C [1] (data from MRSA252) SACOL_RS02780 ribose-phosphate pyrophosphokinase [1] (data from MRSA252) SACOL_RS02850 cysteine synthase [1] (data from MRSA252) SACOL_RS02875 lysine--tRNA ligase [1] (data from MRSA252) SACOL_RS02930 pyridoxal 5'-phosphate synthase lyase subunit PdxS [1] (data from MRSA252) SACOL_RS03025 50S ribosomal protein L11 [1] (data from MRSA252) SACOL_RS03030 50S ribosomal protein L1 [1] (data from MRSA252) SACOL_RS03075 elongation factor G [1] (data from MRSA252) SACOL_RS03080 elongation factor Tu [1] (data from MRSA252) SACOL_RS03275 phosphate acetyltransferase [1] (data from MRSA252) SACOL_RS03540 metal ABC transporter substrate-binding protein [1] (data from MRSA252) SACOL_RS04310 aldehyde dehydrogenase [1] (data from MRSA252) SACOL_RS04320 triose-phosphate isomerase [1] (data from MRSA252) SACOL_RS04330 enolase [1] (data from MRSA252) SACOL_RS04840 NADH dehydrogenase [1] (data from MRSA252) SACOL_RS04950 glucose-6-phosphate isomerase [1] (data from MRSA252) SACOL_RS05630 pyruvate dehydrogenase E1 component subunit alpha [1] (data from MRSA252) SACOL_RS05635 pyruvate dehydrogenase E1 component subunit beta [1] (data from MRSA252) SACOL_RS05640 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex [1] (data from MRSA252) SACOL_RS05645 dihydrolipoyl dehydrogenase [1] (data from MRSA252) SACOL_RS05900 thiol reductase thioredoxin [1] (data from MRSA252) SACOL_RS06405 30S ribosomal protein S16 [1] (data from MRSA252) SACOL_RS06445 succinyl-CoA ligase subunit beta [1] (data from MRSA252) SACOL_RS06505 30S ribosomal protein S2 [1] (data from MRSA252) SACOL_RS06515 elongation factor Ts [1] (data from MRSA252) SACOL_RS06575 translation initiation factor IF-2 [1] (data from MRSA252) SACOL_RS06770 glutamine synthetase [1] (data from MRSA252) SACOL_RS07010 transketolase [1] (data from MRSA252) SACOL_RS07050 aconitate hydratase [1] (data from MRSA252) SACOL_RS07385 dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex [1] (data from MRSA252) SACOL_RS07705 DNA-binding protein HU [1] (data from MRSA252) SACOL_RS07720 30S ribosomal protein S1 [1] (data from MRSA252) SACOL_RS08345 molecular chaperone DnaK [1] (data from MRSA252) SACOL_RS08680 50S ribosomal protein L21 [1] (data from MRSA252) SACOL_RS08795 trigger factor [1] (data from MRSA252) SACOL_RS08905 isocitrate dehydrogenase (NADP(+)) [1] (data from MRSA252) SACOL_RS08930 pyruvate kinase [1] (data from MRSA252) SACOL_RS09000 acetate kinase [1] (data from MRSA252) SACOL_RS09045 30S ribosomal protein S4 [1] (data from MRSA252) SACOL_RS09125 formate--tetrahydrofolate ligase [1] (data from MRSA252) SACOL_RS09385 transaldolase [1] (data from MRSA252) SACOL_RS10210 non-heme ferritin [1] (data from MRSA252) SACOL_RS10360 manganese-dependent inorganic pyrophosphatase [1] (data from MRSA252) SACOL_RS10530 molecular chaperone GroEL [1] (data from MRSA252) SACOL_RS11075 fructose-bisphosphate aldolase [1] (data from MRSA252) SACOL_RS11435 Asp23/Gls24 family envelope stress response protein [1] (data from MRSA252) SACOL_RS11615 30S ribosomal protein S9 [1] (data from MRSA252) SACOL_RS11620 50S ribosomal protein L13 [1] (data from MRSA252) SACOL_RS11655 30S ribosomal protein S11 [1] (data from MRSA252) SACOL_RS11660 30S ribosomal protein S13 [1] (data from MRSA252) SACOL_RS11685 50S ribosomal protein L15 [1] (data from MRSA252) SACOL_RS11695 30S ribosomal protein S5 [1] (data from MRSA252) SACOL_RS11705 50S ribosomal protein L6 [1] (data from MRSA252) SACOL_RS11710 30S ribosomal protein S8 [1] (data from MRSA252) SACOL_RS11720 50S ribosomal protein L5 [1] (data from MRSA252) SACOL_RS11750 30S ribosomal protein S3 [1] (data from MRSA252) SACOL_RS11765 50S ribosomal protein L2 [1] (data from MRSA252) SACOL_RS11775 50S ribosomal protein L4 [1] (data from MRSA252) SACOL_RS11780 50S ribosomal protein L3 [1] (data from MRSA252) SACOL_RS12080 2-hydroxyacid dehydrogenase [1] (data from MRSA252) SACOL_RS13365 pyruvate oxidase [1] (data from MRSA252) SACOL_RS13460 L-glutamate gamma-semialdehyde dehydrogenase [1] (data from MRSA252) SACOL_RS13695 L-lactate dehydrogenase [1] (data from MRSA252) SACOL_RS13720 class I fructose-bisphosphate aldolase [1] (data from MRSA252) SACOL_RS13915 arginine deiminase [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: SaeR see SACOL2004
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 1.48 1.49 1.50 1.51 1.52 1.53 1.54 1.55 1.56 1.57 1.58 1.59 1.60 1.61 1.62 1.63 1.64 1.65 1.66 1.67 1.68 1.69 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)