From AureoWiki
Revision as of 11:14, 11 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "gene Genbank" to "gene RefSeq")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS08520 [old locus tag: SACOL1670 ]
  • pan locus tag?: SAUPAN004211000
  • symbol: SACOL_RS08520
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS08520 [old locus tag: SACOL1670 ]
  • symbol: SACOL_RS08520
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1698141..1698449
  • length: 309
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_002951 (1698141..1698449) NCBI
  • BioCyc: G1G4B-1786 BioCyc
  • MicrobesOnline: see SACOL1670

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGACTGAACATAATCATGATTCACAACTAGAAATTAATAACGAAGAAGAATTATTAACT
    TTATTCGATGAAGAGGGAAATGAAGTTTTATACCGAAAAGTTTTAGAATTTTATCATCCT
    GAATTCAAAAAAGAGTATGTTATCTTAGCTGAAGAAGGTGCTCAATCAGATGAAGACGAT
    ATGATTGAGCTTGTACCAATGATCAATGAACCAGATGAGTCAGGTGACGGTGGTAAGTTA
    GTACCAATCGAAACTGATGAAGAATGGGACATGATTGAAGAAGTTGTAAATACTGAAATG
    GAAGAATAA
    60
    120
    180
    240
    300
    309

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL_RS08520 [old locus tag: SACOL1670 ]
  • symbol: SACOL_RS08520
  • description: hypothetical protein
  • length: 102
  • theoretical pI: 3.56659
  • theoretical MW: 11948.9
  • GRAVY: -0.813725

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SACOL1670
  • PFAM:
    no clan defined DUF1292; Protein of unknown function (DUF1292) (PF06949; HMM-score: 43.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001044
    • TAT(Tat/SPI): 0.000215
    • LIPO(Sec/SPII): 0.000193
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTEHNHDSQLEINNEEELLTLFDEEGNEVLYRKVLEFYHPEFKKEYVILAEEGAQSDEDDMIELVPMINEPDESGDGGKLVPIETDEEWDMIEEVVNTEMEE

Experimental data[edit | edit source]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]