From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS08085 [old locus tag: SACOL1587 ]
  • pan locus tag?: SAUPAN004106000
  • symbol: SACOL_RS08085
  • pan gene symbol?: efp
  • synonym:
  • product: elongation factor P

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS08085 [old locus tag: SACOL1587 ]
  • symbol: SACOL_RS08085
  • product: elongation factor P
  • replicon: chromosome
  • strand: -
  • coordinates: 1621582..1622139
  • length: 558
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_002951 (1621582..1622139) NCBI
  • BioCyc: SACOL_RS08085 BioCyc
  • MicrobesOnline: see SACOL1587

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGATTTCGGTTAATGATTTTAAAACAGGTTTAACAATTTCTGTTGATAACGCTATTTGG
    AAAGTTATAGACTTCCAACATGTAAAGCCTGGTAAAGGTTCAGCATTCGTTCGTTCAAAA
    TTACGTAATTTAAGAACTGGTGCAATTCAAGAGAAAACGTTTAGAGCTGGTGAAAAAGTT
    GAACCAGCAATGATTGAAAATCGTCGCATGCAATATTTATATGCTGACGGAGATAATCAT
    GTATTTATGGATAATGAAAGCTTTGAACAAACAGAACTTTCAAGTGATTACTTAAAAGAA
    GAATTGAATTACTTAAAAGAAGGTATGGAAGTACAAATTCAAACATACGAAGGTGAAACT
    ATCGGTGTTGAATTACCTAAAACTGTTGAATTAACAGTAACTGAAACAGAACCTGGTATT
    AAAGGTGATACTGCAACTGGTGCCACTAAATCGGCAACTGTTGAAACTGGTTATACATTA
    AATGTACCTTTATTTGTAAACGAAGGTGACGTTTTAATTATCAACACTGGTGATGGAAGC
    TACATTTCAAGAGGATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    558

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL_RS08085 [old locus tag: SACOL1587 ]
  • symbol: SACOL_RS08085
  • description: elongation factor P
  • length: 185
  • theoretical pI: 4.46265
  • theoretical MW: 20553.9
  • GRAVY: -0.41027

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Translation factors translation elongation factor P (TIGR00038; HMM-score: 265.8)
    and 2 more
    Genetic information processing Protein synthesis Translation factors elongation factor P-like protein YeiP (TIGR02178; HMM-score: 127.2)
    Genetic information processing Protein synthesis Translation factors translation elongation factor IF5A (TIGR00037; HMM-score: 22.7)
  • TheSEED: see SACOL1587
  • PFAM:
    KOW (CL0107) EFP_N; Elongation factor P (EF-P) KOW-like domain (PF08207; HMM-score: 96.5)
    OB (CL0021) Elong-fact-P_C; Elongation factor P, C-terminal (PF09285; HMM-score: 90.7)
    EFP; Elongation factor P (EF-P) OB domain (PF01132; HMM-score: 82.6)
    and 1 more
    no clan defined SMC_Nse1; Nse1 non-SMC component of SMC5-6 complex (PF07574; HMM-score: 15)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002655
    • TAT(Tat/SPI): 0.000227
    • LIPO(Sec/SPII): 0.00036
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MISVNDFKTGLTISVDNAIWKVIDFQHVKPGKGSAFVRSKLRNLRTGAIQEKTFRAGEKVEPAMIENRRMQYLYADGDNHVFMDNESFEQTELSSDYLKEELNYLKEGMEVQIQTYEGETIGVELPKTVELTVTETEPGIKGDTATGATKSATVETGYTLNVPLFVNEGDVLIINTGDGSYISRG

Experimental data[edit | edit source]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. 1.000 1.001 1.002 1.003 1.004 1.005 1.006 1.007 1.008 1.009 1.010 1.011 1.012 1.013 1.014 1.015 1.016 1.017 1.018 1.019 1.020 1.021 1.022 1.023 1.024 1.025 1.026 1.027 1.028 1.029 1.030 1.031 1.032 1.033 1.034 1.035 1.036 1.037 1.038 1.039 1.040 1.041 1.042 1.043 1.044 1.045 1.046 1.047 1.048 1.049 1.050 1.051 1.052 1.053 1.054 1.055 1.056 1.057 1.058 1.059 1.060 1.061 1.062 1.063 1.064 1.065 1.066 1.067 1.068 1.069 1.070 1.071 1.072 1.073 1.074 1.075 1.076 1.077 1.078 1.079 1.080 1.081 1.082 1.083 1.084 1.085 1.086 1.087 1.088 1.089 1.090 1.091 1.092 1.093 1.094 1.095 1.096 1.097 1.098 1.099 1.100 1.101 1.102 1.103 1.104 1.105 1.106 1.107 1.108 1.109 1.110 1.111 1.112 1.113 1.114 1.115 1.116 1.117 1.118 1.119 1.120 1.121 1.122 1.123 1.124 1.125 1.126 1.127 1.128 1.129 1.130 1.131 1.132 1.133 1.134 1.135 1.136 1.137 1.138 1.139 1.140 1.141 1.142 1.143 1.144 1.145 1.146 1.147 1.148 1.149 1.150 1.151 1.152 1.153 1.154 1.155 1.156 1.157 1.158 1.159 1.160 1.161 1.162 1.163 1.164 1.165 1.166 1.167 1.168 1.169 1.170 1.171 1.172 1.173 1.174 1.175 1.176 1.177 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]