Jump to navigation
Jump to search
(Created page with "<protect> <aureodatabase>NCBI date</aureodatabase> =Summary= * <aureodatabase>organism</aureodatabase> * <aureodatabase>locus</aureodatabase> * <aureodatabase>pan locus</aur...") |
m (Text replacement - "gene Genbank" to "gene RefSeq") |
||
(One intermediate revision by the same user not shown) | |||
Line 1: | Line 1: | ||
__TOC__ | |||
<protect> | <protect> | ||
<aureodatabase> | <aureodatabase>annotation</aureodatabase> | ||
=Summary= | =Summary= | ||
* <aureodatabase>organism</aureodatabase> | *<aureodatabase>organism</aureodatabase> | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>pan locus</aureodatabase> | *<aureodatabase>pan locus</aureodatabase> | ||
* <aureodatabase>gene symbol</aureodatabase> | *<aureodatabase>gene symbol</aureodatabase> | ||
* <aureodatabase>pan gene symbol</aureodatabase> | *<aureodatabase>pan gene symbol</aureodatabase> | ||
* <aureodatabase>gene synonyms</aureodatabase> | *<aureodatabase>gene synonyms</aureodatabase> | ||
* <aureodatabase>product</aureodatabase> | *<aureodatabase>product</aureodatabase> | ||
</protect> | </protect> | ||
Line 24: | Line 25: | ||
==General== | ==General== | ||
* <aureodatabase>gene type</aureodatabase> | *<aureodatabase>gene type</aureodatabase> | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>gene symbol</aureodatabase> | *<aureodatabase>gene symbol</aureodatabase> | ||
* <aureodatabase>product</aureodatabase> | *<aureodatabase>product</aureodatabase> | ||
* <aureodatabase>gene replicon</aureodatabase> | *<aureodatabase>gene replicon</aureodatabase> | ||
* <aureodatabase>strand</aureodatabase> | *<aureodatabase>strand</aureodatabase> | ||
* <aureodatabase>gene coordinates</aureodatabase> | *<aureodatabase>gene coordinates</aureodatabase> | ||
* <aureodatabase>gene length</aureodatabase> | *<aureodatabase>gene length</aureodatabase> | ||
* <aureodatabase>essential</aureodatabase> | *<aureodatabase>essential</aureodatabase> | ||
*<aureodatabase>gene comment</aureodatabase> | |||
</protect> | </protect> | ||
Line 38: | Line 40: | ||
==Accession numbers== | ==Accession numbers== | ||
* <aureodatabase>gene | *<aureodatabase>gene location</aureodatabase> | ||
* <aureodatabase>gene | *<aureodatabase>gene BioCyc</aureodatabase> | ||
*<aureodatabase>gene MicrobesOnline</aureodatabase> | |||
</protect> | </protect> | ||
<protect> | <protect> | ||
==Phenotype== | ==Phenotype== | ||
</protect> | </protect> | ||
Share your knowledge and add information here. [<span class="plainlinks">[//aureowiki.med.uni-greifswald.de/index.php?title={{PAGENAMEE}}&veaction=edit§ion=6 edit]</span>] | |||
<protect> | <protect> | ||
==DNA sequence== | ==DNA sequence== | ||
* <aureodatabase>gene sequence</aureodatabase> | *<aureodatabase>gene sequence</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
<aureodatabase>RNA regulated operons</aureodatabase> | |||
</protect> | |||
<protect> | |||
=Protein= | =Protein= | ||
<aureodatabase>protein 3D view</aureodatabase> | <aureodatabase>protein 3D view</aureodatabase> | ||
==General== | ==General== | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>protein symbol</aureodatabase> | *<aureodatabase>protein symbol</aureodatabase> | ||
* <aureodatabase>protein description</aureodatabase> | *<aureodatabase>protein description</aureodatabase> | ||
* <aureodatabase>protein length</aureodatabase> | *<aureodatabase>protein length</aureodatabase> | ||
* <aureodatabase>theoretical pI</aureodatabase> | *<aureodatabase>theoretical pI</aureodatabase> | ||
* <aureodatabase>theoretical MW</aureodatabase> | *<aureodatabase>theoretical MW</aureodatabase> | ||
* <aureodatabase>GRAVY</aureodatabase> | *<aureodatabase>GRAVY</aureodatabase> | ||
</protect> | </protect> | ||
Line 71: | Line 77: | ||
==Function== | ==Function== | ||
* <aureodatabase>protein reaction</aureodatabase> | *<aureodatabase>protein reaction</aureodatabase> | ||
* <aureodatabase>protein TIGRFAM</aureodatabase> | *<aureodatabase>protein TIGRFAM</aureodatabase> | ||
* <aureodatabase>protein TheSeed</aureodatabase> | *<aureodatabase>protein TheSeed</aureodatabase> | ||
* <aureodatabase>protein PFAM</aureodatabase> | *<aureodatabase>protein PFAM</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
==Structure, modifications & | ==Structure, modifications & cofactors== | ||
* <aureodatabase>protein domains</aureodatabase> | *<aureodatabase>protein domains</aureodatabase> | ||
* <aureodatabase>protein modifications</aureodatabase> | *<aureodatabase>protein modifications</aureodatabase> | ||
* <aureodatabase>protein cofactors</aureodatabase> | *<aureodatabase>protein cofactors</aureodatabase> | ||
* <aureodatabase>protein effectors</aureodatabase> | *<aureodatabase>protein effectors</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein regulated operons</aureodatabase> | ||
</protect> | </protect> | ||
Line 90: | Line 96: | ||
==Localization== | ==Localization== | ||
* <aureodatabase>protein Psortb</aureodatabase> | *<aureodatabase>protein Psortb</aureodatabase> | ||
* <aureodatabase>protein LocateP</aureodatabase> | *<aureodatabase>protein LocateP</aureodatabase> | ||
* <aureodatabase>protein SignalP</aureodatabase> | *<aureodatabase>protein SignalP</aureodatabase> | ||
* <aureodatabase>protein TMHMM</aureodatabase> | *<aureodatabase>protein TMHMM</aureodatabase> | ||
</protect> | </protect> | ||
Line 99: | Line 105: | ||
==Accession numbers== | ==Accession numbers== | ||
* <aureodatabase>protein GI</aureodatabase> | *<aureodatabase>protein GI</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein RefSeq</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein UniProt</aureodatabase> | ||
</protect> | </protect> | ||
Line 108: | Line 113: | ||
==Protein sequence== | ==Protein sequence== | ||
* <aureodatabase>protein sequence</aureodatabase> | *<aureodatabase>protein sequence</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
== | ==Experimental data== | ||
* <aureodatabase>protein validated peptides</aureodatabase> | *<aureodatabase>protein validated peptides</aureodatabase> | ||
*<aureodatabase>protein validated localization</aureodatabase> | |||
*<aureodatabase>protein validated quantitative data</aureodatabase> | |||
*<aureodatabase>protein partners</aureodatabase> | |||
</protect> | </protect> | ||
Line 125: | Line 133: | ||
==Operon== | ==Operon== | ||
* <aureodatabase>operons</aureodatabase> | *<aureodatabase>operons</aureodatabase> | ||
</protect> | </protect> | ||
Line 131: | Line 139: | ||
==Regulation== | ==Regulation== | ||
*<aureodatabase>regulators</aureodatabase> | |||
* <aureodatabase>regulators</aureodatabase> | |||
</protect> | </protect> | ||
Line 138: | Line 145: | ||
==Transcription pattern== | ==Transcription pattern== | ||
* <aureodatabase>expression browser</aureodatabase> | *<aureodatabase>expression browser</aureodatabase> | ||
</protect> | </protect> | ||
Line 144: | Line 151: | ||
==Protein synthesis (provided by Aureolib)== | ==Protein synthesis (provided by Aureolib)== | ||
* <aureodatabase>protein synthesis Aureolib</aureodatabase> | *<aureodatabase>protein synthesis Aureolib</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
== | ==Protein stability== | ||
* <aureodatabase>protein half-life</aureodatabase> | *<aureodatabase>protein half-life</aureodatabase> | ||
</protect> | </protect> | ||
Latest revision as of 11:36, 11 March 2016
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS05565 [old locus tag: SACOL1090 ]
- pan locus tag?: SAUPAN003302000
- symbol: SACOL_RS05565
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS05565 [old locus tag: SACOL1090 ]
- symbol: SACOL_RS05565
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1101089..1101631
- length: 543
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541ATGGGATTCAAAAACAATTTAACATCAAATTTAACAAATAAAATCGGTAATTCAGTCTTT
AAAATAGAAAATGTTGACGGAAAAGGTGCAATGCCAACGACGATTCAAGAATTGAGAGAA
AGACGACAACGTGCTGAAGCAATTGTAAAGAGAAAGTCTTTAATGTCATCAACAATGAGC
GTTGTTCCAATTCCGGGTTTAGATTTTGGTGTTGATTTAAAATTAATGAAAGATATTATC
GAAGATGTTAATAAAATTTATGGTTTAGATCATAAGCAAGTTAATAGCCTTGGGGATGAT
GTGAAAGAAAGAATTATGTCTGCAGCAGCAATTCAAGGTAGTCAATTTATTGGTAAAAGA
ATTTCAAATGCATTTTTAAAAATTGTAATTAGAGATGTAGCTAAACGTACTGCTGCAAAA
CAAACAAAATGGTTTCCTGTTGTAGGACAAGCTGTGTCTGCATCTATTAGTTACTATTTT
ATGAATAAAATTGGAAAAGATCACATTCAAAAATGCGAAAATGTTATTAAAAATGTCATG
TAG60
120
180
240
300
360
420
480
540
543
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS05565 [old locus tag: SACOL1090 ]
- symbol: SACOL_RS05565
- description: hypothetical protein
- length: 180
- theoretical pI: 10.5911
- theoretical MW: 20089.4
- GRAVY: -0.225556
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SACOL1090
- PFAM: no clan defined DUF697; Domain of unknown function (DUF697) (PF05128; HMM-score: 21.5)and 2 moreP-loop_NTPase (CL0023) IIGP; Interferon-inducible GTPase (IIGP) (PF05049; HMM-score: 15.1)no clan defined DUF1262; Protein of unknown function (DUF1262) (PF06880; HMM-score: 12.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009644
- TAT(Tat/SPI): 0.011134
- LIPO(Sec/SPII): 0.000854
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MGFKNNLTSNLTNKIGNSVFKIENVDGKGAMPTTIQELRERRQRAEAIVKRKSLMSSTMSVVPIPGLDFGVDLKLMKDIIEDVNKIYGLDHKQVNSLGDDVKERIMSAAAIQGSQFIGKRISNAFLKIVIRDVAKRTAAKQTKWFPVVGQAVSASISYYFMNKIGKDHIQKCENVIKNVM
⊟Experimental data[edit | edit source]
- experimentally validated: see SACOL1090
- protein localization: see SACOL1090
- quantitative data / protein copy number per cell: see SACOL1090
- interaction partners:
SACOL_RS07610 (asnC) asparagine--tRNA ligase [1] (data from MRSA252) SACOL_RS11135 (deoA) pyrimidine-nucleoside phosphorylase [1] (data from MRSA252) SACOL_RS00030 DNA polymerase III subunit beta [1] (data from MRSA252) SACOL_RS00065 serine--tRNA ligase [1] (data from MRSA252) SACOL_RS00470 peptidoglycan-binding protein LysM [1] (data from MRSA252) SACOL_RS00620 2-deoxyribose-5-phosphate aldolase [1] (data from MRSA252) SACOL_RS01040 formate acetyltransferase [1] (data from MRSA252) SACOL_RS01135 L-lactate dehydrogenase [1] (data from MRSA252) SACOL_RS01215 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [1] (data from MRSA252) SACOL_RS02200 30S ribosomal protein S6 [1] (data from MRSA252) SACOL_RS02210 30S ribosomal protein S18 [1] (data from MRSA252) SACOL_RS02285 alkyl hydroperoxide reductase subunit C [1] (data from MRSA252) SACOL_RS02315 hypothetical protein [1] (data from MRSA252) SACOL_RS02330 IMP dehydrogenase [1] (data from MRSA252) SACOL_RS02335 GMP synthase (glutamine-hydrolyzing) [1] (data from MRSA252) SACOL_RS02790 50S ribosomal protein L25/general stress protein Ctc [1] (data from MRSA252) SACOL_RS02850 cysteine synthase [1] (data from MRSA252) SACOL_RS02930 pyridoxal 5'-phosphate synthase lyase subunit PdxS [1] (data from MRSA252) SACOL_RS03025 50S ribosomal protein L11 [1] (data from MRSA252) SACOL_RS03030 50S ribosomal protein L1 [1] (data from MRSA252) SACOL_RS03035 50S ribosomal protein L10 [1] (data from MRSA252) SACOL_RS03040 50S ribosomal protein L7/L12 [1] (data from MRSA252) SACOL_RS03050 DNA-directed RNA polymerase subunit beta [1] (data from MRSA252) SACOL_RS03055 DNA-directed RNA polymerase subunit beta' [1] (data from MRSA252) SACOL_RS03070 30S ribosomal protein S7 [1] (data from MRSA252) SACOL_RS03075 elongation factor G [1] (data from MRSA252) SACOL_RS03080 elongation factor Tu [1] (data from MRSA252) SACOL_RS03275 phosphate acetyltransferase [1] (data from MRSA252) SACOL_RS03415 zinc-dependent alcohol dehydrogenase [1] (data from MRSA252) SACOL_RS03540 metal ABC transporter substrate-binding protein [1] (data from MRSA252) SACOL_RS03755 LysR family transcriptional regulator [1] (data from MRSA252) SACOL_RS04075 ribonucleotide-diphosphate reductase subunit alpha [1] (data from MRSA252) SACOL_RS04190 ribosomal subunit interface protein [1] (data from MRSA252) SACOL_RS04260 thioredoxin reductase [1] (data from MRSA252) SACOL_RS04290 ATP-dependent Clp protease proteolytic subunit [1] (data from MRSA252) SACOL_RS04310 aldehyde dehydrogenase [1] (data from MRSA252) SACOL_RS04315 phosphoglycerate kinase [1] (data from MRSA252) SACOL_RS04320 triose-phosphate isomerase [1] (data from MRSA252) SACOL_RS04330 enolase [1] (data from MRSA252) SACOL_RS04490 thiol reductase thioredoxin [1] (data from MRSA252) SACOL_RS04840 NADH dehydrogenase [1] (data from MRSA252) SACOL_RS04925 NAD-specific glutamate dehydrogenase [1] (data from MRSA252) SACOL_RS04950 glucose-6-phosphate isomerase [1] (data from MRSA252) SACOL_RS04980 hypothetical protein [1] (data from MRSA252) SACOL_RS05055 beta-ketoacyl-[acyl-carrier-protein] synthase II [1] (data from MRSA252) SACOL_RS05135 oligoendopeptidase F [1] (data from MRSA252) SACOL_RS05185 enoyl-ACP reductase [1] (data from MRSA252) SACOL_RS05205 hypothetical protein [1] (data from MRSA252) SACOL_RS05375 1,4-dihydroxy-2-naphthoyl-CoA synthase [1] (data from MRSA252) SACOL_RS05575 phosphoenolpyruvate--protein phosphotransferase [1] (data from MRSA252) SACOL_RS05630 pyruvate dehydrogenase E1 component subunit alpha [1] (data from MRSA252) SACOL_RS05635 pyruvate dehydrogenase E1 component subunit beta [1] (data from MRSA252) SACOL_RS05640 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex [1] (data from MRSA252) SACOL_RS05645 dihydrolipoyl dehydrogenase [1] (data from MRSA252) SACOL_RS05900 thiol reductase thioredoxin [1] (data from MRSA252) SACOL_RS06140 cell division protein FtsZ [1] (data from MRSA252) SACOL_RS06340 hypothetical protein [1] (data from MRSA252) SACOL_RS06420 50S ribosomal protein L19 [1] (data from MRSA252) SACOL_RS06445 succinyl-CoA ligase subunit beta [1] (data from MRSA252) SACOL_RS06505 30S ribosomal protein S2 [1] (data from MRSA252) SACOL_RS06515 elongation factor Ts [1] (data from MRSA252) SACOL_RS06575 translation initiation factor IF-2 [1] (data from MRSA252) SACOL_RS06600 polyribonucleotide nucleotidyltransferase [1] (data from MRSA252) SACOL_RS06770 glutamine synthetase [1] (data from MRSA252) SACOL_RS07010 transketolase [1] (data from MRSA252) SACOL_RS07050 aconitate hydratase [1] (data from MRSA252) SACOL_RS07385 dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex [1] (data from MRSA252) SACOL_RS07390 2-oxoglutarate dehydrogenase E1 component [1] (data from MRSA252) SACOL_RS07440 glucose-specific phosphotransferase enzyme IIA component [1] (data from MRSA252) SACOL_RS07525 serine/threonine dehydratase [1] (data from MRSA252) SACOL_RS07680 nucleoside-diphosphate kinase [1] (data from MRSA252) SACOL_RS07705 DNA-binding protein HU [1] (data from MRSA252) SACOL_RS07720 30S ribosomal protein S1 [1] (data from MRSA252) SACOL_RS07920 phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating) [1] (data from MRSA252) SACOL_RS08210 superoxide dismutase [1] (data from MRSA252) SACOL_RS08270 glycine--tRNA ligase [1] (data from MRSA252) SACOL_RS08345 molecular chaperone DnaK [1] (data from MRSA252) SACOL_RS08680 50S ribosomal protein L21 [1] (data from MRSA252) SACOL_RS08795 trigger factor [1] (data from MRSA252) SACOL_RS08820 50S ribosomal protein L20 [1] (data from MRSA252) SACOL_RS08830 translation initiation factor IF-3 [1] (data from MRSA252) SACOL_RS08840 threonine--tRNA ligase [1] (data from MRSA252) SACOL_RS08905 isocitrate dehydrogenase (NADP(+)) [1] (data from MRSA252) SACOL_RS08930 pyruvate kinase [1] (data from MRSA252) SACOL_RS08935 ATP-dependent 6-phosphofructokinase [1] (data from MRSA252) SACOL_RS08950 NAD-dependent malic enzyme 4 [1] (data from MRSA252) SACOL_RS08995 universal stress protein UspA [1] (data from MRSA252) SACOL_RS09000 acetate kinase [1] (data from MRSA252) SACOL_RS09045 30S ribosomal protein S4 [1] (data from MRSA252) SACOL_RS09125 formate--tetrahydrofolate ligase [1] (data from MRSA252) SACOL_RS09225 D-alanine aminotransferase [1] (data from MRSA252) SACOL_RS09230 dipeptidase PepV [1] (data from MRSA252) SACOL_RS09385 transaldolase [1] (data from MRSA252) SACOL_RS10210 non-heme ferritin [1] (data from MRSA252) SACOL_RS10250 aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [1] (data from MRSA252) SACOL_RS10530 molecular chaperone GroEL [1] (data from MRSA252) SACOL_RS10535 co-chaperone GroES [1] (data from MRSA252) SACOL_RS10760 anti-sigma B factor antagonist [1] (data from MRSA252) SACOL_RS10840 DEAD/DEAH box family ATP-dependent RNA helicase [1] (data from MRSA252) SACOL_RS10850 D-alanine--D-alanine ligase [1] (data from MRSA252) SACOL_RS10940 beta-hydroxyacyl-ACP dehydratase [1] (data from MRSA252) SACOL_RS11050 50S ribosomal protein L31 type B [1] (data from MRSA252) SACOL_RS11060 aldehyde dehydrogenase family protein [1] (data from MRSA252) SACOL_RS11070 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [1] (data from MRSA252) SACOL_RS11075 fructose-bisphosphate aldolase [1] (data from MRSA252) SACOL_RS11150 purine-nucleoside phosphorylase [1] (data from MRSA252) SACOL_RS11230 glutamine--fructose-6-phosphate aminotransferase [1] (data from MRSA252) SACOL_RS11435 Asp23/Gls24 family envelope stress response protein [1] (data from MRSA252) SACOL_RS11615 30S ribosomal protein S9 [1] (data from MRSA252) SACOL_RS11620 50S ribosomal protein L13 [1] (data from MRSA252) SACOL_RS11645 50S ribosomal protein L17 [1] (data from MRSA252) SACOL_RS11650 DNA-directed RNA polymerase subunit alpha [1] (data from MRSA252) SACOL_RS11655 30S ribosomal protein S11 [1] (data from MRSA252) SACOL_RS11660 30S ribosomal protein S13 [1] (data from MRSA252) SACOL_RS11685 50S ribosomal protein L15 [1] (data from MRSA252) SACOL_RS11700 50S ribosomal protein L18 [1] (data from MRSA252) SACOL_RS11705 50S ribosomal protein L6 [1] (data from MRSA252) SACOL_RS11710 30S ribosomal protein S8 [1] (data from MRSA252) SACOL_RS11720 50S ribosomal protein L5 [1] (data from MRSA252) SACOL_RS11725 50S ribosomal protein L24 [1] (data from MRSA252) SACOL_RS11735 30S ribosomal protein S17 [1] (data from MRSA252) SACOL_RS11750 30S ribosomal protein S3 [1] (data from MRSA252) SACOL_RS11755 50S ribosomal protein L22 [1] (data from MRSA252) SACOL_RS11760 30S ribosomal protein S19 [1] (data from MRSA252) SACOL_RS11765 50S ribosomal protein L2 [1] (data from MRSA252) SACOL_RS11770 50S ribosomal protein L23 [1] (data from MRSA252) SACOL_RS11775 50S ribosomal protein L4 [1] (data from MRSA252) SACOL_RS11780 50S ribosomal protein L3 [1] (data from MRSA252) SACOL_RS11785 30S ribosomal protein S10 [1] (data from MRSA252) SACOL_RS12080 2-hydroxyacid dehydrogenase [1] (data from MRSA252) SACOL_RS12655 amino acid ABC transporter substrate-binding protein [1] (data from MRSA252) SACOL_RS12675 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [1] (data from MRSA252) SACOL_RS13460 L-glutamate gamma-semialdehyde dehydrogenase [1] (data from MRSA252) SACOL_RS13695 L-lactate dehydrogenase [1] (data from MRSA252) SACOL_RS13720 class I fructose-bisphosphate aldolase [1] (data from MRSA252) SACOL_RS13725 malate:quinone oxidoreductase [1] (data from MRSA252) SACOL_RS13910 ornithine carbamoyltransferase [1] (data from MRSA252) SACOL_RS13915 arginine deiminase [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: SigB* see SACOL1090
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.000 1.001 1.002 1.003 1.004 1.005 1.006 1.007 1.008 1.009 1.010 1.011 1.012 1.013 1.014 1.015 1.016 1.017 1.018 1.019 1.020 1.021 1.022 1.023 1.024 1.025 1.026 1.027 1.028 1.029 1.030 1.031 1.032 1.033 1.034 1.035 1.036 1.037 1.038 1.039 1.040 1.041 1.042 1.043 1.044 1.045 1.046 1.047 1.048 1.049 1.050 1.051 1.052 1.053 1.054 1.055 1.056 1.057 1.058 1.059 1.060 1.061 1.062 1.063 1.064 1.065 1.066 1.067 1.068 1.069 1.070 1.071 1.072 1.073 1.074 1.075 1.076 1.077 1.078 1.079 1.080 1.081 1.082 1.083 1.084 1.085 1.086 1.087 1.088 1.089 1.090 1.091 1.092 1.093 1.094 1.095 1.096 1.097 1.098 1.099 1.100 1.101 1.102 1.103 1.104 1.105 1.106 1.107 1.108 1.109 1.110 1.111 1.112 1.113 1.114 1.115 1.116 1.117 1.118 1.119 1.120 1.121 1.122 1.123 1.124 1.125 1.126 1.127 1.128 1.129 1.130 1.131 1.132 1.133 1.134 1.135 1.136 1.137 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)