From AureoWiki
Revision as of 12:21, 11 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS04680 [old locus tag: SACOL0912 ]
  • pan locus tag?: SAUPAN002892000
  • symbol: SACOL_RS04680
  • pan gene symbol?: —
  • synonym:
  • product: CsbD family protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS04680 [old locus tag: SACOL0912 ]
  • symbol: SACOL_RS04680
  • product: CsbD family protein
  • replicon: chromosome
  • strand: +
  • coordinates: 919637..919831
  • length: 195
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_002951 (919637..919831) NCBI
  • BioCyc: G1G4B-991 BioCyc
  • MicrobesOnline: see SACOL0912

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGGCAGACGAAAGTAAATTTGAACAAGCAAAAGGTAATGTTAAAGAAACAGTAGGTAAT
    GTTACTGATAATAAAAATTTAGAAAACGAAGGTAAAGAAGATAAAGCTTCTGGTAAAGCG
    AAAGAATTCGTTGAAAATGCAAAAGAAAAAGCAACTGATTTTATTGATAAAGTAAAAGGT
    AACAAAGGCGAGTAA
    60
    120
    180
    195

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL_RS04680 [old locus tag: SACOL0912 ]
  • symbol: SACOL_RS04680
  • description: CsbD family protein
  • length: 64
  • theoretical pI: 4.86657
  • theoretical MW: 7018.64
  • GRAVY: -1.35781

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SACOL0912
  • PFAM:
    YjbJ-CsbD-like (CL0406) CsbD; CsbD-like (PF05532; HMM-score: 57.7)
    and 4 more
    no clan defined MT0933_antitox; MT0933-like antitoxin protein (PF14013; HMM-score: 14.1)
    YtxH; YtxH-like protein (PF12732; HMM-score: 13.7)
    LEA_4; Late embryogenesis abundant protein (PF02987; HMM-score: 13.4)
    HSP9_HSP12; Heat shock protein 9/12 (PF04119; HMM-score: 12.8)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.015799
    • TAT(Tat/SPI): 0.00346
    • LIPO(Sec/SPII): 0.005712
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MADESKFEQAKGNVKETVGNVTDNKNLENEGKEDKASGKAKEFVENAKEKATDFIDKVKGNKGE

⊟Experimental data[edit | edit source]

  • experimentally validated: see SACOL0912
  • protein localization: see SACOL0912
  • quantitative data / protein copy number per cell: see SACOL0912
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SACOL_RS04680&oldid=99050"