From AureoWiki
Jump to navigation Jump to search
m (Text replacement - "<protect> =Summary= * <aureodatabase>organism" to "<protect> <aureodatabase>NCBI date</aureodatabase> =Summary= * <aureodatabase>organism")
m (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "")
Line 101: Line 101:
* <aureodatabase>protein GI</aureodatabase>
* <aureodatabase>protein GI</aureodatabase>
* <aureodatabase>protein UniProt</aureodatabase>
* <aureodatabase>protein UniProt</aureodatabase>
* <aureodatabase>protein Genbank</aureodatabase>
* <aureodatabase>protein RefSeq</aureodatabase>
* <aureodatabase>protein RefSeq</aureodatabase>
</protect>
</protect>

Revision as of 20:20, 10 March 2016

PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL2642
  • symbol: SACOL2642
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2702176..2702289
  • length: 114
  • essential: unknown

Accession numbers[edit | edit source]

  • Gene ID: 3237063 NCBI
  • gene Genbank : _

Phenotype[edit | edit source]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    ATGAATAGAAATATCAATAAGAAAAATAATATGATTAAAAATGATGAATGGCATACTTAT
    AAAGTGTCTAAATATTGGCGGTCAATATTACTTACAAACACGAATGTTAAGTAA
    60
    114

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL2642
  • symbol: SACOL2642
  • description: hypothetical protein
  • length: 37
  • theoretical pI: 10.8721
  • theoretical MW: 4596.28
  • GRAVY: -1.22703

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED:
  • PFAM:

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • interaction partners:

Localization[edit | edit source]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0.24
    • Cytoplasmic Membrane Score: 0.05
    • Cellwall Score: 0.8
    • Extracellular Score: 8.91
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.256521
    • TAT(Tat/SPI): 0.0088
    • LIPO(Sec/SPII): 0.0464
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MNRNINKKNNMIKNDEWHTYKVSKYWRSILLTNTNVK

Peptides[edit | edit source]

  • experimentally validated:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • sigma factors : _
  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]